DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and Sply

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_652032.1 Gene:Sply FlyBaseID:FBgn0010591 Length:545 Species:Drosophila melanogaster

Alignment Length:420 Identity:82/421 (19%)
Similarity:146/421 (35%) Gaps:147/421 (35%)


Human   156 LRSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAG------RIITESLNTSQYT- 213
            |..:|.|:::||.    ::...:||||..:.:...||    |:.|      .::||....:.|| 
  Fly   103 LPEKGLSKEEILR----LVDEHLKTGHYNWRDGRVSG----AVYGYKPDLVELVTEVYGKASYTN 159

Human   214 ---YEIAPVFVLMEEEVLRKLRALV-GWSSGDGIFCPGGSISNMYAVNLAR-YQRYPDCKQRGLR 273
               .::.|....||.||:|....|. |.|:..|....||:.|.:.|:...| :.|    :.:|: 
  Fly   160 PLHADLFPGVCKMEAEVVRMACNLFHGNSASCGTMTTGGTESIVMAMKAYRDFAR----EYKGI- 219

Human   274 TLP----PLALFTSKEVGKRHRPNPGLLILISSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWS 334
            |.|    |..:..:.:.|.::         .:.||        |..|:.|               
  Fly   220 TRPNIVVPKTVHAAFDKGGQY---------FNIHV--------RSVDVDP--------------- 252

Human   335 PRIWRGRLVWPRLRLTFHFFETFILDSGAVPFLVSATSGTTVL----------GAFDPLEAIADV 389
                                ||:.:|   :.....|.:..|:|          |..|.:||||.:
  Fly   253 --------------------ETYEVD---IKKFKRAINRNTILLVGSAPNFPYGTIDDIEAIAAL 294

Human   390 CQRHGLWLHVDAAWGGSVL-LSQTHRHLLD----GIQRADSVAWNPHKLLAAGLQCSALLLQD-- 447
            ..::.:.:||||..|..|: |.:...:.|.    .::...|::.:.||...|....|.:|..|  
  Fly   295 GVKYDIPVHVDACLGSFVVALVRNAGYKLRPFDFEVKGVTSISADTHKYGFAPKGSSVILYSDKK 359

Human   448 --------------------------TSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRR 486
                                      ...::..|..:..|:      .||..|:...::|...|.
  Fly   360 YKDHQFTVTTDWPGGVYGSPTVNGSRAGGIIAACWATMMSF------GYDGYLEATKRIVDTARY 418

Human   487 VDCLKLWLMWKAQGDQGLERRIDQAFVLAR 516
            :             ::|: |.||..|:..:
  Fly   419 I-------------ERGV-RDIDGIFIFGK 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 73/392 (19%)
SplyNP_652032.1 DOPA_deC_like 132..494 CDD:99743 73/388 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.