DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and CG5618

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_649211.1 Gene:CG5618 FlyBaseID:FBgn0036975 Length:510 Species:Drosophila melanogaster

Alignment Length:546 Identity:233/547 (43%)
Similarity:325/547 (59%) Gaps:70/547 (13%)


Human    93 REILMADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELR 157
            |:.||.|.:.|.:       |..|||......||.  ||..  .||:..:.:|::||:|::|::|
  Fly    15 RDGLMDDWKILEN-------VFHLLRKEDTFCVDP--QKWD--KQKIVPFLQPDKLKELINLKVR 68

Human   158 -SQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFV 221
             ::..|..:|.|.|:.||.|||||.|.||.||||..|||..|||.::||::|.|.||||:||||.
  Fly    69 ETENCSLAEIEELCQQVIHYSVKTSHGRFHNQLFGQLDPFGLAGALVTEAMNGSTYTYEVAPVFS 133

Human   222 LMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKE- 285
            |:|.||:..:..|.|:..|||||.||||.||||.:.||||:..|:.|..|:..:.||.||||.| 
  Fly   134 LIETEVIATICKLAGYKEGDGIFAPGGSTSNMYGMVLARYKIAPEVKTSGMFGMRPLVLFTSDES 198

Human   286 ----VGKRHRPNPGLLILISSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPR 346
                |...:....|....:|  |.|..|.::...||...::|                     .:
  Fly   199 HYSFVKAANWLGLGSYNCVS--VRTNERGQMLLDDLEAKIAE---------------------AK 240

Human   347 LRLTFHFFETFILDSGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQ 411
            .|             |..||.|:.|:|||||||||.:...|||.:||||||||||..||:.|||.
  Fly   241 AR-------------GGEPFFVNCTAGTTVLGAFDDINGAADVTERHGLWLHVDACLGGAALLSA 292

Human   412 THRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDT 476
            .:|.|:.|::||:|.:|||||.:.|.||||..|.:::..||:||:.::|.|||||||||||:.||
  Fly   293 KNRSLIAGLERANSFSWNPHKTIGAPLQCSLFLTRESGRLLERCNSTEAHYLFQQDKFYDVSYDT 357

Human   477 GDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKR-EGFELVM-EPEFVNV 539
            |:|.|||||::|..|.|||.||:|.......:|.|..:||.|..::::| :.|.||: |.|:.||
  Fly   358 GNKSVQCGRKIDAFKFWLMLKARGYGKYGLMVDHAIHIARLLEGKLRQRGDRFRLVIPEHEYSNV 422

Human   540 CFWFVPPSLR--GKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTR--GNFFRVVVANSA 600
            ||||:|.::|  .::|:|::..||..|||.:||:|...|::||||.|...:  |||||:|     
  Fly   423 CFWFIPKAMRVSSEEETPEWWSRLYTVAPKIKEQMAHSGTLMIGYSPLKAKNLGNFFRMV----- 482

Human   601 LTC------ADMDFLLNELERLGQDL 620
            .||      .::||:|:|:||||:.:
  Fly   483 FTCFPILKSKELDFILDEIERLGEKI 508

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 197/448 (44%)
CG5618NP_649211.1 AAT_I 97..504 CDD:302748 197/448 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45677
Phylome 1 0.910 0.690 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.