DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and Gad1

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_001261396.1 Gene:Gad1 FlyBaseID:FBgn0004516 Length:510 Species:Drosophila melanogaster

Alignment Length:520 Identity:218/521 (42%)
Similarity:323/521 (62%) Gaps:39/521 (7%)


Human   105 SLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILER 169
            ::...|...|.||: |..|::| .::.....::||.::..||::|:||||::..:....:|::|.
  Fly    26 TVTAGPETREFLLK-VIDVLLD-FVKATNDRNEKVLDFHHPEDMKRLLDLDVPDRALPLQQLIED 88

Human   170 CRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRAL 234
            |...::|.||||||.|||||.:|||..::||..:|.:.||:.:||||||||:|||..||.|:|.:
  Fly    89 CATTLKYQVKTGHPHFFNQLSNGLDLISMAGEWLTATANTNMFTYEIAPVFILMENVVLTKMREI 153

Human   235 VGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLP-PLALFTSKEVGKRHRPNPGLLI 298
            :|||.||.|..|||||||:||...||::.:|:.|:.|...|| .|.:|||.:.....:....:..
  Fly   154 IGWSGGDSILAPGGSISNLYAFLAARHKMFPNYKEHGSVGLPGTLVMFTSDQCHYSIKSCAAVCG 218

Human   299 LISSH-VTTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPRLRLTFHFFETFILDSG 362
            |.:.| :..||....:.     ..||..||:.|.|                           ..|
  Fly   219 LGTDHCIVVPSDEHGKM-----ITSELERLILERK---------------------------AKG 251

Human   363 AVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRH-LLDGIQRADSV 426
            .:||.|:||:|||||||||.:..|||:||::..|:|:||||||.:|:|:.||| ...|::|||||
  Fly   252 DIPFFVNATAGTTVLGAFDDINTIADICQKYNCWMHIDAAWGGGLLMSRKHRHPRFTGVERADSV 316

Human   427 AWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLK 491
            .||||||:.|.||||.:..:: ..||..|:...|.|||..||.||::.||||||:||||..|..|
  Fly   317 TWNPHKLMGALLQCSTIHFKE-DGLLISCNQMSAEYLFMTDKQYDISYDTGDKVIQCGRHNDIFK 380

Human   492 LWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKR-EGFELVMEPEFVNVCFWFVPPSLRGKQESP 555
            |||.|:|:|.:|.|::.|:...|.:|.::.:::: :.|.|::|||.|||.||:||..|||.....
  Fly   381 LWLQWRAKGTEGFEQQQDRLMELVQYQLKRIREQSDRFHLILEPECVNVSFWYVPKRLRGVPHDA 445

Human   556 DYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL 620
            .....|.|:.|::|.||:::|::|:||||...|.||||.:::::|:..||:||:|:|:.|||.||
  Fly   446 KKEVELGKICPIIKGRMMQKGTLMVGYQPDDRRPNFFRSIISSAAVNEADVDFMLDEIHRLGDDL 510

Human   621  620
              Fly   511  510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 188/435 (43%)
Gad1NP_001261396.1 Pyridoxal_deC 64..434 CDD:278699 175/403 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127644
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.