DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and Hdc

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_001260855.1 Gene:Hdc FlyBaseID:FBgn0005619 Length:847 Species:Drosophila melanogaster

Alignment Length:521 Identity:119/522 (23%)
Similarity:200/522 (38%) Gaps:113/522 (22%)


Human   130 QKGTSVSQKVCEWKE------------PEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGH 182
            |:|..:...:.::.|            |..::|||......:||...:|......::...:....
  Fly     8 QRGKEMVDYIADYLENIRERRVFPDVSPGYMRQLLPESAPIEGEPWPKIFSDVERIVMPGITHWQ 72

Human   183 PRFFNQLFSGLDP-HALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVG---------- 236
            ....:..|..|:. .:|.|.::.:::|...:|:..:|....:|..|:..|..::|          
  Fly    73 SPHMHAYFPALNSMPSLLGDMLADAINCLGFTWASSPACTELEIIVMNWLGKMIGLPDAFLHLSS 137

Human   237 WSSGDGIFCPGGSISNMYAVNLAR-------YQRYPD-------------CKQRGLRTLPPLALF 281
            .|.|.|:.....|.:.:..:...|       ::|:|.             |..:...::...||.
  Fly   138 QSQGGGVLQTTASEATLVCLLAGRTRAIQRFHERHPGYQDAEINARLVAYCSDQAHSSVEKAALI 202

Human   282 TSKEVGKRHRPNPGLLILISSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPR 346
                         ||:             .:|:.:....::...:|:||.               
  Fly   203 -------------GLV-------------RMRYIEADDDLAMRGKLLREA--------------- 226

Human   347 LRLTFHFFETFILDSGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQ 411
                   .|..| ..|.|||.|.||.|||...:||.||.|..||..|.||||||||:.||..:..
  Fly   227 -------IEDDI-KQGLVPFWVCATLGTTGSCSFDNLEEIGIVCAEHHLWLHVDAAYAGSAFICP 283

Human   412 THRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDT 476
            ..|..|.||:||||:|:||.|.|......:||.::| |..:.|....:..||  |.:...||:|.
  Fly   284 EFRTWLRGIERADSIAFNPSKWLMVHFDATALWVRD-STAVHRTFNVEPLYL--QHENSGVAVDF 345

Human   477 GDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCF 541
            ....:...||...||:|.:.::.|.:||:|.|.:...||:.....:.....|||..:.....|.|
  Fly   346 MHWQIPLSRRFRALKVWFVLRSYGIKGLQRHIREGVRLAQKFEALVLADHRFELPAKRHLGLVVF 410

Human   542 WFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNF-FRVVVANSALTCAD 605
                 .:||..|          :...|.:|:...|::..  .|...:|.: .|..:.::..|..|
  Fly   411 -----RIRGDNE----------ITEKLLKRLNHRGNLHC--IPSSLKGQYVIRFTITSTHTTLDD 458

Human   606 M 606
            :
  Fly   459 I 459

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 109/455 (24%)
HdcNP_001260855.1 Pyridoxal_deC 35..413 CDD:278699 105/435 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.