DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and Tdc1

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_610226.2 Gene:Tdc1 FlyBaseID:FBgn0259977 Length:587 Species:Drosophila melanogaster

Alignment Length:447 Identity:114/448 (25%)
Similarity:185/448 (41%) Gaps:79/448 (18%)


Human   124 VVDEAIQKGTSVSQK-VCEWKEPEELKQLLDLELRSQGESQKQILERC-RAVIRYSVKTGHPRFF 186
            |:|...|.||::.:: |....:|..||:||..:.....|..|.:||.. :.::...|...||:||
  Fly    13 VIDYICQYGTNIEERDVAPTLDPGYLKKLLPADAPQSPEPFKDVLEDFEQKIMPGVVHWNHPKFF 77

Human   187 NQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVG----------WSSGD 241
            ....||....::.|.:::.::.:..:::...|....:|..|:......:|          .|:|.
  Fly    78 AYFPSGNSFPSVLGDMLSSAIGSIGFSWASCPAAAELETIVMNWYAKALGLPKAFVSDAPGSTGG 142

Human   242 GIFCPGGSISNMYAVNL--ARYQRYPDCK-QRGLRT---LPPLALFTSKEVGKRHRPNPGLLILI 300
            |..  .||.|....|:|  ||.:...:.| |..:..   ||.|..:.|:|               
  Fly   143 GAL--QGSASECVLVSLITARARAISELKGQTSVHDSVFLPSLIAYASRE--------------- 190

Human   301 SSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPRLRLTFHFFETFILDSGAVP 365
             :|.:.....::....|        |::...:      .||:   |:.|.....:..: ::|..|
  Fly   191 -AHSSVEKATKMALVKL--------RIIDADE------HGRM---RVDLLRQAIQNDV-NAGLTP 236

Human   366 FLVSATSGTTVLGAFDPLEAIADVC-QRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVAWN 429
            |.|.||.|||...|||.:..|..|| |...:|||||.|:.|:..:....|....|::.|||...|
  Fly   237 FFVVATVGTTGGCAFDDITEIGKVCRQVSSIWLHVDGAYAGNSFILPEMRVFSAGLEYADSFNTN 301

Human   430 PHKLLAAGLQCSALLLQDTSNL----------LKRCHGSQASYLFQQDKFYDVALDTGDKVVQCG 484
            |:|||......|||.::|..||          |:..|.:...|     :.|.:.|         .
  Fly   302 PNKLLLTNFDASALWVRDVMNLKSALNVNPLYLRHEHLTGVDY-----RHYGIPL---------S 352

Human   485 RRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCF 541
            ||...||||.:::..|.:||:..|.....||:.....::|.|.||:..:.....|||
  Fly   353 RRFRALKLWFVFRTYGIRGLQEYIRNHMALAKKFEMLVRKDERFEVRNDVHLGLVCF 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 96/385 (25%)
Tdc1NP_610226.2 Pyridoxal_deC 35..412 CDD:278699 108/426 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.