DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSAD and Ddc

DIOPT Version :9

Sequence 1:XP_024304779.1 Gene:CSAD / 51380 HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_724163.1 Gene:Ddc / 35190 FlyBaseID:FBgn0000422 Length:510 Species:Drosophila melanogaster


Alignment Length:268 Identity:77/268 - (28%)
Similarity:114/268 - (42%) Gaps:37/268 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   362 GAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSV 426
            |.:||....|.|||...|||.|:....|..:|.||:|||||:.||..:...:|||:.||:.|||.
  Fly   267 GLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIESADSF 331

Human   427 AWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFY---DV---ALDTGDKVVQCGR 485
            .:||||.:.....|||:.|:|.|.::.         .|..|..|   |:   |.|.....:..||
  Fly   332 NFNPHKWMLVNFDCSAMWLKDPSWVVN---------AFNVDPLYLKHDMQGSAPDYRHWQIPLGR 387

Human   486 RVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRG 550
            |...||||.:.:..|.:.|:..|.:....|:...:.......|||..|.....|||     .|:|
  Fly   388 RFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCF-----RLKG 447

Human   551 KQESPDYHERLSKVAPVLKERMVK--EGSMMIGYQPHGTRGNFF-RVVVANSALTCADMDFLLNE 612
            ..|.              .|.::|  .|...|...|...:..:| |:.:.:......||::...|
  Fly   448 SNER--------------NEALLKRINGRGHIHLVPAKIKDVYFLRMAICSRFTQSEDMEYSWKE 498

Human   613 LERLGQDL 620
            :.....::
  Fly   499 VSAAADEM 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 77/262 (29%)
DdcNP_724163.1 Pyridoxal_deC 70..446 CDD:278699 64/192 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.