DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and b

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_001246025.1 Gene:b FlyBaseID:FBgn0000153 Length:575 Species:Drosophila melanogaster

Alignment Length:604 Identity:263/605 (43%)
Similarity:364/605 (60%) Gaps:61/605 (10%)


Human    39 HFTEAARLGWRKAQGPSLGASVAGRNGTGSAHTCAFSPSARRSYLCTLPPALL-----------S 92
            ||.|:....:....|..| |||:....|.:......||:...|.:.....:.:           :
  Fly    11 HFKESIFKPYSTTSGDDL-ASVSPLTATAALVASTSSPADSTSTVAFEQASKMLANAANNNNNNN 74

Human    93 REILMADSEALPSLAGDPVA-VEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLEL 156
            ..|.....:....:|..|.| .|..:||....::..|:.:||:.|.||.||.||.||:||.|.:|
  Fly    75 NNITSTKDDLSSFVASHPAAEFEGFIRACVDEIIKLAVFQGTNRSSKVVEWHEPAELRQLFDFQL 139

Human   157 RSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFV 221
            |.|||||.::.|..|..||:|||||||.|.|||:||:||:||.|:.:|::||.|.||||:||:|.
  Fly   140 REQGESQDKLRELLRETIRFSVKTGHPYFINQLYSGVDPYALVGQWLTDALNPSVYTYEVAPLFT 204

Human   222 LMEEEVLRKLRALVGW---SSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTS 283
            ||||:||.::|.:||:   ..|||||||||||:|.||::.|||:..|:.|:.||....||.:|||
  Fly   205 LMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANGYAISCARYRHSPESKKNGLFNAKPLIIFTS 269

Human   284 KEVGKRHRPNPGLLILI---SSHVTTPSRRE---LRFWDLAPTVSEWSRLMREGKWSPRIWRGRL 342
            ::.   |.....|.:.:   |.||...:..|   :|..||...|    :|..|..|.        
  Fly   270 EDA---HYSVEKLAMFMGFGSDHVRKIATNEVGKMRLSDLEKQV----KLCLENGWQ-------- 319

Human   343 VWPRLRLTFHFFETFILDSGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSV 407
                                  |.:||||:|||||||||.|..|::||:::.:|:||||||||..
  Fly   320 ----------------------PLMVSATAGTTVLGAFDDLAGISEVCKKYNMWMHVDAAWGGGA 362

Human   408 LLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDV 472
            |:|:.:||||:||:|||||.|||||||||..|||..|.:. ..:|.:||.:.|:||||:|||||.
  Fly   363 LMSKKYRHLLNGIERADSVTWNPHKLLAASQQCSTFLTRH-QQVLAQCHSTNATYLFQKDKFYDT 426

Human   473 ALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVME-PEF 536
            :.|||||.:|||||.|..|.|.||||:|.||||..:::.|.:|.:...::::|.|||||:| ||.
  Fly   427 SFDTGDKHIQCGRRADVFKFWFMWKAKGTQGLEAHVEKVFRMAEFFTAKVRERPGFELVLESPEC 491

Human   537 VNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSAL 601
            .|:.||:|||.||..:.:.::::||.||||.:||.|:|:|||||.|||.....||||:|:.||.|
  Fly   492 TNISFWYVPPGLREMERNREFYDRLHKVAPKVKEGMIKKGSMMITYQPLRQLPNFFRLVLQNSCL 556

Human   602 TCADMDFLLNELERLGQDL 620
            ..:||.:.|:|:|.|.|:|
  Fly   557 EESDMVYFLDEIESLAQNL 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 208/441 (47%)
bNP_001246025.1 AAT_I 128..499 CDD:302748 196/409 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170460719
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 532 1.000 Inparanoid score I1197
Isobase 1 0.950 0.918296 Normalized mean entropy S2959
OMA 1 1.010
OrthoDB 1 1.010 D162307at33208
OrthoFinder 1 1.000 FOG0000412
OrthoInspector 1 1.000 T609058
orthoMCL 1 0.900 OOG5_127644
Panther 1 1.100 O PTHR45677
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5043
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.750

Return to query results.
Submit another query.