DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSAD and Tdc2

Sequence 1:XP_024304779.1 Gene:CSAD HGNCID:18966 Length:620 Species:Homo sapiens
Sequence 2:NP_724489.1 Gene:Tdc2 FlyBaseID:FBgn0050446 Length:637 Species:Drosophila melanogaster

Alignment Length:530 Identity:132/531 (25%)
Similarity:205/531 (39%) Gaps:109/531 (21%)


Human   130 QKGTSVSQKVCEW------------KEPEELKQLLDLELRSQGESQKQILERCRAVIRYSV-KTG 181
            ::|..:.:.:|.:            .||..|:.||..|...:.|...||:......|...| ...
  Fly     8 KRGMEMVEYICNYLETLNERRVTPSVEPGYLRHLLPPEAPQEPEDWDQIMRDVEDKIMPGVTHWQ 72

Human   182 HPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVG---------- 236
            ||||.....:|....::.|.::.:.:....:::..:|....:|..||..|...:|          
  Fly    73 HPRFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIGLPDHFLALKE 137

Human   237 WSSGDGIFCPGGSISNMYAVNLARYQ-------RYPDCKQRGLRTLPPLALFTSKEVGKRHR--P 292
            .|:|.|:.....|...:..:..||.|       ::|..::..|  |..|..:.|||.   |.  .
  Fly   138 GSTGGGVIQTSASECVLVTMLAARAQALKRLKAQHPFVEEGHL--LSKLMAYCSKEA---HSCVE 197

Human   293 NPGLLILISSHVTTPSRRELRFWDLAPTVSEWSRLMREGKWSPRIWRGRLVWPRLRLTFHFFETF 357
            ...::..:...:..|.       |.|..                  ||:.:          :|..
  Fly   198 KAAMICFVKLRILEPD-------DDASL------------------RGQTI----------YEAM 227

Human   358 ILD--SGAVPFLVSATSGTTVLGAFDPLEAIADVCQRH-GLWLHVDAAWGGSVLLSQTHRHLLDG 419
            ..|  .|.|||.||.|.|||...|||.|..|....||. |:|||||||:.|:..:....:.||.|
  Fly   228 EEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFICPELKPLLKG 292

Human   420 IQRADSVAWNPHKLLAAGLQCSALLLQD----TSNLLKRCHGSQASYLFQQDKFYDVALDTGDKV 480
            |:.|||...||:|.|.....||.|.::|    ||.|:       ...|:.:..:.|.|:|.....
  Fly   293 IEYADSFNTNPNKWLLTNFDCSTLWVRDRIRLTSALV-------VDPLYLKHGYSDAAIDYRHWG 350

Human   481 VQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVP 545
            |...||...||||.:.::.|..||:..|.....||:...|.:.|.:.||:..:.:...|||    
  Fly   351 VPLSRRFRSLKLWFVLRSYGISGLQHYIRHHIKLAKRFEELVLKDKRFEICNQVKLGLVCF---- 411

Human   546 PSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDF-- 608
             .|:|   |...:|:|..:       :.:.|.:.:.....|.|.......||.:| |..|:|:  
  Fly   412 -RLKG---SDKLNEKLLSI-------INESGKLHMVPASVGDRYIIRFCAVAQNA-TAEDIDYAW 464

Human   609 -----LLNEL 613
                 ..|||
  Fly   465 DIIVDFANEL 474

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSADXP_024304779.1 DOPA_deC_like 185..616 CDD:99743 116/463 (25%)
Tdc2NP_724489.1 Pyridoxal_deC 35..414 CDD:278699 113/431 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.