DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Atp8a2 and CG33298

Sequence 1:XP_006519295.1 Gene:Atp8a2 MGIID:1354710 Length:1188 Species:Mus musculus
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1306 Identity:418/1307 (32%)
Similarity:634/1307 (49%) Gaps:266/1307 (20%)


Mouse    46 SVGDQLEAPA-RIIYLN---------QSHLN-KFCDNRISTAKYSVLTFLPRFLYEQIRRAANAF 99
            :.||:.|..: |.:..|         :.|.| :|..|:|.|.||::|:|:|:.|.||..|.||.:
  Fly   217 NTGDKFEERSYRTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLY 281

Mouse   100 FLFIALLQQIPDVSPTGRYTTLVPLVIILTIAGIKEIIEDFKRHKADNAVNKKKTIVLRNG---M 161
            |:||.||..:|::|..|:...::|::.:|.:..:|::.||.:|..:|..:| ..|..:.:|   .
  Fly   282 FIFIVLLNWVPEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRIN-NTTCRVYDGETER 345

Mouse   162 WHTIMWKEVAVGDIVKVLNGQYLPADMVLFSSSEPQGMCYVETANLDGETNLKIRQGLSHTTDMQ 226
            :..:.|:|:.|||||.:.|.:.:|||::|..:|:|||:||::|.:||||||||.|:.:....:||
  Fly   346 YKKVKWQELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVVRGFEEMQ 410

Mouse   227 TRDVLMKLSGRIECEGPNRHLYDFTGNL-HLDGKSSVALGPDQILLRGTQLRNTQWVFGVVVYTG 290
            :..|..|...|:|.:.|...||.|.|.| |..|: .|.:..:.:|||.::|:||.::.|:|||.|
  Fly   411 SIFVPSKFVSRVEADAPTTKLYRFHGALIHPTGE-RVPISTECLLLRESRLKNTDYIEGIVVYAG 474

Mouse   291 HDSKLMQNSTKAPLKRSNVEKVTNVQILVLFGILLVMALVSSVGALFWNGS--HGGKSWYI--KK 351
            |::|.|.|::....|||.||:..|:.::....|||::.:|.::|...|..|  |.... |:  .|
  Fly   475 HETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPVP-YLPPNK 538

Mouse   352 MDTNSDNFGYNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDMDMYYIENDTPAMARTSNLN 416
            :..|.::. :...|:|::...:||:||.||:|:.|..|...|:.::|::..|.:.....|..|:.
  Fly   539 LTANMESM-WIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQTECRAMNIT 602

Mouse   417 EELGQVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFP-ELAREQSSDDFCRMTSCTNDSCDFND 480
            |||||::::|:|||||||.|.|.|::|.:.|..|.|.| ||.:..|...........||:.: :|
  Fly   603 EELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLIPNDNLN-SD 666

Mouse   481 PRLLKNIEDQHPTAPCIQEFLTLLAVCHTVV----PEKD-------------------------- 515
            ...|.......|.|..|||||.:||:|:||:    |.:|                          
  Fly   667 MAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPANLKHGKQR 731

Mouse   516 ------------------------------GDEII------------------------------ 520
                                          .|..|                              
  Fly   732 QKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPAQSHQPTLS 796

Mouse   521 ----------------------------------------------------------------- 520
                                                                             
  Fly   797 PISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQGKRMKLPSS 861

Mouse   521 --------------YQASSPDEAALVKGAKKLGFVFTGRTPYSVIIE--AMGQEQTFGILNVLEF 569
                          |:|.||||.|||..|.........|:|..:::.  ..|..:.:.||.||.|
  Fly   862 KTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREYEILKVLPF 926

Mouse   570 SSDRKRMSVIVR-LPSGQLRLYCKGADNVIFERL------SKDSKYMEETLCHLEYFATEGLRTL 627
            .|.||.||::|| :.|.::.||.||||:.|...|      |.:....|:|...|:.:|.||||.|
  Fly   927 DSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRYAREGLRIL 991

Mouse   628 CVAYADLSENEYEEWLKVYQEASIILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPETIA 692
            .:|...|:..:|.:|...:||..:.|::|.:||.:.:..:|.||.|||||.||||||.|||||||
  Fly   992 VMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQDGVPETIA 1056

Mouse   693 TLLKAEIKIWVLTGDKQETAINIGYSCRLVSQNMALILLKEDSLDATRAAITQHCTDLGN----- 752
            :||.|.|.:|||||||.||||||.||.:|.:|.|.||.|...|.||...||..:.||:.|     
  Fly  1057 SLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTDMENDKTTS 1121

Mouse   753 LLG-----KENDVALIIDGHTLKYAL--SFEVRRSFLDLALSCKAVICCRVSPLQKSEIVDVVKK 810
            .||     ::...||::||.||.:.|  ..::...||.|:..|.:|:|||.:||||:.:|.|||:
  Fly  1122 TLGYGQSLRKKQRALVVDGKTLTFILDPKSKLILPFLRLSKRCASVLCCRSTPLQKAYLVKVVKE 1186

Mouse   811 RVKAITLAIGDGANDVGMIQTAHVGVGISGNEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRV 875
            .:...|||||||||||.|||.|.|||||||.|||||...:|:.:.:|.|||:|||.||.|.|:|:
  Fly  1187 ELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAADFTLPRFRYLERLLLAHGYWCYDRL 1251

Mouse   876 TKCILYCFYKNVVLYIIELWFAFVNGFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESM 940
            ::.|||.||||.....:..|:....|||||::.::..:.|||:|||:|||..:|::::...::.:
  Fly  1252 SRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLYNLIFTSLPPLAIGVYDKRVAEDLL 1316

Mouse   941 LRFPQLYRITQNAEGFNTKVFWGHCINALVHSLILFWVPMKA-LEHDTPVTSGHATDYLFVGNIV 1004
            |:.|.||:..:....:....||...::||..||::|:|.:.| .|.|             ||...
  Fly  1317 LKNPYLYKNGRLGVAYRPHDFWLILLDALYQSLVIFFVALCAYAESD-------------VGIWE 1368

Mouse  1005 YTYVVVTVCLKAGL-----ETTAWTKFSHLAV---WGSMLIWLVF--------FGVYSTIWPTIP 1053
            :...:...||.|.|     |..:||....|::   .||..::.:.        |||.|:.|... 
  Fly  1369 FGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFAIVYDSVCMNCFGVRSSYWVIF- 1432

Mouse  1054 IAPDMKGQATMVLSSAYFWLGLFL-----VPTACLIEDVAWRAAKHTCKKTLLEEVQELETKSRV 1113
                      :..:||..||.:.|     |....|:..|..........|.:|:..:|     |.
  Fly  1433 ----------VCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQSKRE-----RS 1482

Mouse  1114 MGKAML 1119
            .|:|:|
  Fly  1483 RGEALL 1488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Atp8a2XP_006519295.1 PhoLip_ATPase_N 57..119 CDD:292826 26/72 (36%)
ATPase-Plipid 68..1106 CDD:273734 406/1259 (32%)
E1-E2_ATPase 125..>210 CDD:278548 31/88 (35%)
Cation_ATPase 506..604 CDD:289987 42/276 (15%)
HAD_like <816..845 CDD:304363 25/29 (86%)
PhoLip_ATPase_C 848..1099 CDD:292829 77/273 (28%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 23/50 (46%)
ATPase-Plipid 250..1473 CDD:273734 405/1252 (32%)
E1-E2_ATPase 302..>394 CDD:278548 32/93 (34%)
Cation_ATPase <880..965 CDD:289987 32/85 (38%)
HAD_like <1177..1240 CDD:304363 38/63 (60%)
PhoLip_ATPase_C 1223..1468 CDD:292829 76/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.