DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RDH8 and CG31937

Sequence 1:NP_056540.3 Gene:RDH8 HGNCID:14423 Length:311 Species:Homo sapiens
Sequence 2:NP_608616.2 Gene:CG31937 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster

Alignment Length:197 Identity:60/198 (30%)
Similarity:97/198 (49%) Gaps:15/198 (8%)


Human     6 RTVLISGCSSGIGLELAVQLAHDPKKRYQVVATMRDLG-----KKETLEAAAGEALGQTLTVAQL 65
            :.|.|:|.|||||..||:.||....|   :|.:.|.|.     ::|.|.||.|....:.:.|.|:
  Fly    47 QVVWITGASSGIGRALALSLARHGVK---LVLSARRLEQLEQVQEECLAAARGLLATKDVLVIQM 108

Human    66 DVCSDESVAQCLSCIQG---EVDVLVNNAGMGLVGPLEGLSLAAMQNVFDTNFFGAVRLVKAVLP 127
            |:...:.....|:.:..   .:||||||||.........:.:...:.:|:.:.|..|.|.:.|:.
  Fly   109 DMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVR 173

Human   128 GMKRRR--QGHIVVISSVMGLQGVIFNDVYAASKFALEGFFESLAIQLLQFNIFISLVEPGPVVT 190
            ....:.  :|||...||:.|...|.|:..|.|:|.||..:..||.:::.:.:  :||..|||:.|
  Fly   174 YFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLD--VSLFAPGPIAT 236

Human   191 EF 192
            :|
  Fly   237 DF 238

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RDH8NP_056540.3 type1_17beta-HSD-like_SDR_c 6..262 CDD:187666 60/198 (30%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 60/198 (30%)
adh_short 47..245 CDD:278532 60/198 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.