DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP5F1B and ATPsynbeta

Sequence 1:NP_001677.2 Gene:ATP5F1B HGNCID:830 Length:529 Species:Homo sapiens
Sequence 2:NP_001259081.1 Gene:ATPsynbeta FlyBaseID:FBgn0010217 Length:511 Species:Drosophila melanogaster

Alignment Length:526 Identity:438/527 (83%)
Similarity:467/527 (89%) Gaps:30/527 (6%)


Human     1 MLGFVGRVAAAPASGALRRLTPSASLPPAQLLLRAAPTAVHPVRDYAAQTSPSPKAGAATGRIVA 65
            :|.|:|:::.||.|                            .|.:||:.:.:  |.||.|:|||
  Fly    14 LLPFLGQLSTAPFS----------------------------ARSHAAKAAKA--AAAANGKIVA 48

Human    66 VIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGA 130
            |||||||||||:.||||||||||..|..||||||||||||:|||||||||||||||||||||:|.
  Fly    49 VIGAVVDVQFDDNLPPILNALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGY 113

Human   131 PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAP 195
            ||:||||.||||||:|||||||||||||.|.:.|.||||||||::||||||||||||||||||||
  Fly   114 PIRIPVGAETLGRIINVIGEPIDERGPIDTDKTAAIHAEAPEFVQMSVEQEILVTGIKVVDLLAP 178

Human   196 YAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKD 260
            ||||||||||||||||||||||||||||||||||||||||||||||||||||:||||.|||:|||
  Fly   179 YAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVISLKD 243

Human   261 ATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRI 325
            .||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   244 KTSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRI 308

Human   326 PSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIA 390
            |||||||||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   309 PSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIA 373

Human   391 ELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVS 455
            ||||||||||||||||||||||:|.|||:|||||||||||||||||||||||||||||||||||:
  Fly   374 ELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVA 438

Human   456 RARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKA 520
            ||||||||||||||||||||||.||||||::|||||..||||:||||||.||||||||||.|.||
  Fly   439 RARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSAILAGDYDHLPEVAFYMVGPIEEVVEKA 503

Human   521 DKLAEE 526
            |:||:|
  Fly   504 DRLAKE 509

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP5F1BNP_001677.2 PRK09280 58..524 CDD:236447 426/466 (91%)
ATPsynbetaNP_001259081.1 PRK09280 44..507 CDD:236447 424/463 (92%)
ATP-synt_ab_N 46..112 CDD:280947 58/66 (88%)
F1-ATPase_beta 114..393 CDD:238553 264/279 (95%)
ATP-synt_ab_C 401..508 CDD:278722 95/107 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 1 1.000
Homologene 1 1.000 H1273
Inparanoid 1 1.050 839 1.000 Inparanoid score I444
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D278669at33208
OrthoFinder 1 1.000 FOG0002752
OrthoInspector 1 1.000 T1072760
orthoMCL 1 0.900 OOG5_127099
Panther 1 1.100 LDO PTHR15184
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.840

Return to query results.
Submit another query.