DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP5F1B and ATPsynbetaL

Sequence 1:NP_001677.2 Gene:ATP5F1B HGNCID:830 Length:529 Species:Homo sapiens
Sequence 2:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster

Alignment Length:469 Identity:353/470 (75%)
Similarity:408/470 (87%) Gaps:1/470 (0%)


Human    61 GRIVAVIGAVVDVQFDEGLPPILNALEVQGRE-TRLVLEVAQHLGESTVRTIAMDGTEGLVRGQK 124
            |.|.||||.|:||.|:|.:|.:||||:||... ..|||||..|||.:.||.:|||.||||.|||.
  Fly   104 GVIHAVIGPVIDVYFEEEVPEVLNALQVQDAPIANLVLEVFHHLGNNIVRCVAMDSTEGLRRGQP 168

Human   125 VLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKV 189
            |||:|.||::.||...||||:||:|:|||:||.:|:..::.||.||||..::||:.|||||||||
  Fly   169 VLDTGYPIRVAVGKAVLGRILNVVGDPIDDRGEVKSDFYSFIHNEAPELTDLSVKPEILVTGIKV 233

Human   190 VDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESG 254
            :||||||.|||||||||||||||||||||||||:||:|||||||.|.|||||||||||||||||.
  Fly   234 IDLLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAKSHGGYSVFVGAGERTREGNDLYHEMIESK 298

Human   255 VINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVS 319
            ||:|:|.:|||.||:||||||||||:||.|||||:||||||.:||||||||||||||||||||||
  Fly   299 VISLEDDSSKVVLVFGQMNEPPGARSRVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQAGSEVS 363

Human   320 ALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTV 384
            ||||||||||||||||.|||||||||||:|:.||||||||:|||||||:|||||.||:|||||||
  Fly   364 ALLGRIPSAVGYQPTLGTDMGTMQERITSTRNGSITSVQAVYVPADDLSDPAPAATFSHLDATTV 428

Human   385 LSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEE 449
            |||.|||||||||||||||:|||:||::||.|||:|||.|||.||.|||||||||||||||||||
  Fly   429 LSRPIAELGIYPAVDPLDSSSRILDPDVVGEEHYNVARAVQKTLQAYKSLQDIIAILGMDELSEE 493

Human   450 DKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIE 514
            |||||:||||:||||||||||||:||||.|||||:::.::||:::|.||||.:||.||||||..|
  Fly   494 DKLTVARARKMQRFLSQPFQVAEIFTGHPGKLVPVEKCVEGFKRLLNGEYDDIPEIAFYMVGDAE 558

Human   515 EAVAKADKLAEEHS 528
            |.:|||.:||...|
  Fly   559 EVLAKATQLAASMS 572

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP5F1BNP_001677.2 PRK09280 58..524 CDD:236447 351/464 (76%)
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 351/464 (76%)
ATP-synt_ab_N 106..173 CDD:280947 40/67 (60%)
F1-ATPase_beta 175..454 CDD:238553 225/279 (81%)
ATP-synt_ab_C 462..571 CDD:278722 80/109 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C300913060
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S51
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D278669at33208
OrthoFinder 1 1.000 FOG0002752
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127099
Panther 1 1.100 O PTHR15184
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.