DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP5F1B and Utx

Sequence 1:NP_001677.2 Gene:ATP5F1B HGNCID:830 Length:529 Species:Homo sapiens
Sequence 2:NP_609368.3 Gene:Utx FlyBaseID:FBgn0260749 Length:1136 Species:Drosophila melanogaster

Alignment Length:476 Identity:88/477 (18%)
Similarity:150/477 (31%) Gaps:149/477 (31%)


Human    92 ETRLVLEVAQHLGE-STVRTIAMDGTEGLVRGQKV-LDSGAPIKIPVGPETLGRIMNVIGEPIDE 154
            |.::..::| ||.| ......|.||.|.|:..:.: |:..|.:...:|  .:...:..:||. .|
  Fly   226 ELQVKFQIA-HLYEVQNKHKAAKDGYEFLLNEKNISLELKADVYRQLG--WMYHCVECLGEK-KE 286

Human   155 RGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMEL 219
            |           .|.|..|::.|:|              |....|..:.|.|....|        
  Fly   287 R-----------EANALNFLQKSIE--------------ADPKSGQSLYLLGRCYAG-------- 318

Human   220 INNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARA---- 280
               :.|.|..:..:....|:: |||              .|....:.::|.|.|:|..|..    
  Fly   319 ---INKVHDAFLAYRNSVEKS-EGN--------------ADTWCSIGVLYQQQNQPTDALQAYIC 365

Human   281 --------RVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLAT 337
                    :.|.|.|.:. |....:.:|......|..:  |...:.|:|:.:..:....:.|:..
  Fly   366 AVQLDKDHKAAWTNLGIL-YESCGQLRDAYACYLNATK--QISFQKSSLIRKKQAIRMKKDTIGL 427

Human   338 DMGTMQERIT--------------TTKKGSITSVQAIY-----------------------VPAD 365
            ..| :.:|||              |:|:..:.|::..:                       ....
  Fly   428 SKG-LSQRITFLEGQLSQAPLPSITSKRRQLCSIEEAWNLPISLEMNSRQQQTAQMLPRQVTKQS 491

Human   366 DLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVG---------------- 414
            .:..|.|....:.|..:.:.|:.|.|.|. ...:...:.|:....|::.                
  Fly   492 PVQGPPPPYPHSQLSQSPIPSKRIKEDGT-SQQEVTQNNSQTSAQNLINISESLNQRNFNAMPES 555

Human   415 --SEHYDVARGVQKILQD-YKSLQDI-IAILGMDELSEE----------DKLTVSRARKIQRFLS 465
              |....|......|..| ||..:.| :..|..|.||..          |...:|...||| ..|
  Fly   556 NKSSEQSVLDTFDDISNDIYKQNESIKLERLSQDALSNNEDSRHDFIGGDNADISTTFKIQ-MDS 619

Human   466 QPFQVAEVFTGHMGKLVPLKE 486
            :...||.       ||:|:.|
  Fly   620 KQLMVAV-------KLLPIDE 633

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP5F1BNP_001677.2 PRK09280 58..524 CDD:236447 88/477 (18%)
UtxNP_609368.3 TPR repeat 147..181 CDD:276809
TPR_11 156..216 CDD:290150
TPR repeat 186..216 CDD:276809
TPR repeat 228..255 CDD:276809 9/28 (32%)
TPR_11 264..337 CDD:290150 19/113 (17%)
TPR repeat 265..300 CDD:276809 10/49 (20%)
TPR repeat 307..334 CDD:276809 5/38 (13%)
TPR_11 339..402 CDD:290150 13/78 (17%)
TPR repeat 339..369 CDD:276809 7/44 (16%)
TPR_1 340..373 CDD:278916 6/33 (18%)
TPR repeat 374..402 CDD:276809 6/29 (21%)
JmjC 870..978 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.