| Sequence 1: | NP_001677.2 | Gene: | ATP5F1B / 506 | HGNCID: | 830 | Length: | 529 | Species: | Homo sapiens | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001245908.1 | Gene: | lid / 33837 | FlyBaseID: | FBgn0031759 | Length: | 1838 | Species: | Drosophila melanogaster | 
| Alignment Length: | 393 | Identity: | 71/393 - (18%) | 
|---|---|---|---|
| Similarity: | 120/393 - (30%) | Gaps: | 144/393 - (36%) | 
- Green bases have known domain annotations that are detailed below.
| 
Human    83 LNALEVQGRETRLVLEVAQHLGESTVRT------------IAMDGTEGLVRGQK----VLDSGAP 131 
Human   132 IKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPY 196 
Human   197 AKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT-----REGNDLYHEMIESGVI 256 
Human   257 NLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSAL 321 
Human   322 LGRIPS-------------------------AVGYQPTLAT-------------DMGTMQERITT 348 
Human   349 T------------KKGSITSVQAIYVPADD----------------LTDPAPA---TTFAHLDAT 382 
Human   383 TVL 385 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| ATP5F1B | NP_001677.2 | PRK09280 | 58..524 | CDD:236447 | 71/393 (18%) | 
| lid | NP_001245908.1 | JmjN | 160..201 | CDD:128818 | |
| ARID | 227..312 | CDD:198082 | |||
| PHD1_Lid_like | 450..495 | CDD:277078 | |||
| JmjC | 624..740 | CDD:202224 | |||
| zf-C5HC2 | 830..882 | CDD:280996 | |||
| PLU-1 | 896..1229 | CDD:285609 | 63/344 (18%) | ||
| PHD2_KDM5A | 1295..1351 | CDD:277079 | |||
| PHD3_KDM5A_like | 1755..1805 | CDD:277083 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0055 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||