DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6115 and Etfrf1

Sequence 1:NP_001286001.1 Gene:CG6115 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001157100.1 Gene:Etfrf1 MGIID:1914886 Length:86 Species:Mus musculus

Alignment Length:84 Identity:41/85 (48%)
Similarity:65/85 (76%) Gaps:3/85 (4%)


  Fly     2 SQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVE 66
            :.||.:|::|||:|.||||:||  .|...|::::.:.|:.:||.:||:||..|:|:|.::.||:|
Mouse     3 NSLRGEVLTLYKNLLYLGRDYP--KGADYFKRRLKNVFLKNKDVEDPEKIKELIARGEFVMKELE 65

  Fly    67 ALYSLKKYRSVKQRYSYND 85
            |||.|:|||::|||| |:|
Mouse    66 ALYFLRKYRAMKQRY-YSD 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR 7..59 CDD:310152 23/52 (44%)
Etfrf1NP_001157100.1 Complex1_LYR 8..63 CDD:310152 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243460505
eggNOG 1 0.900 E1_2CK7Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1606295at2759
OrthoFinder 1 1.000 FOG0005039
OrthoInspector 1 1.000 T1084366
orthoMCL 1 0.900 OOG5_132226
Panther 1 1.100 LDO PTHR21024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4044
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.