DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6115 and lyrm5b

Sequence 1:NP_001286001.1 Gene:CG6115 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001153447.1 Gene:lyrm5b ZFINID:ZDB-GENE-070424-20 Length:84 Species:Danio rerio

Alignment Length:77 Identity:38/78 (49%)
Similarity:56/78 (72%) Gaps:2/78 (3%)


  Fly     5 RSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVEALY 69
            |::|..|||.|.:||||||  .|...||:::..||..:||.:||.||..|:::|.::.||:||||
Zfish     6 RAEVKQLYKALLFLGREYP--KGADYFRERLRAAFAKNKDMRDPDKIKQLISRGEFVVKELEALY 68

  Fly    70 SLKKYRSVKQRY 81
            .|:|||::|:||
Zfish    69 YLRKYRALKKRY 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR 7..59 CDD:310152 24/52 (46%)
lyrm5bNP_001153447.1 Complex1_LYR_1 7..65 CDD:289974 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243460602
eggNOG 1 0.900 E1_2CK7Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5082
OMA 1 1.010
OrthoDB 1 1.010 D1606295at2759
OrthoFinder 1 1.000 FOG0005039
OrthoInspector 1 1.000 T597520
orthoMCL 1 0.900 OOG5_132226
Panther 1 1.100 O PTHR21024
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.770

Return to query results.
Submit another query.