DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6115 and lyrm5a

Sequence 1:NP_001286001.1 Gene:CG6115 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001153295.1 Gene:lyrm5a ZFINID:ZDB-GENE-050522-203 Length:85 Species:Danio rerio

Alignment Length:78 Identity:42/79 (53%)
Similarity:58/79 (73%) Gaps:2/79 (3%)


  Fly     4 LRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVEAL 68
            ||.:||.|||:|.|||||||  .|...||:::..|||.:||..||:||..|:.:|.::.||:|||
Zfish     5 LRGEVIRLYKNLLYLGREYP--KGTAYFRERLKTAFMKNKDVTDPEKIQKLIDRGDFVIKELEAL 67

  Fly    69 YSLKKYRSVKQRY 81
            |.|:|||::|:||
Zfish    68 YYLRKYRAMKKRY 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR 7..59 CDD:310152 27/52 (52%)
lyrm5aNP_001153295.1 Complex1_LYR_1 8..65 CDD:289974 29/59 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243457986
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5082
OMA 1 1.010
OrthoDB 1 1.010 D1606295at2759
OrthoFinder 1 1.000 FOG0005039
OrthoInspector 1 1.000 T597520
orthoMCL 1 0.900 OOG5_132226
Panther 1 1.100 LDO PTHR21024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4044
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.