DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6115 and Y42A5A.5

DIOPT Version :9

Sequence 1:NP_001286001.1 Gene:CG6115 / 50459 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001024237.2 Gene:Y42A5A.5 / 3565757 WormBaseID:WBGene00012780 Length:99 Species:Caenorhabditis elegans


Alignment Length:82 Identity:41/82 - (50%)
Similarity:61/82 - (74%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVEAL 68
            |||:||.|||:|.::|:||||  |.:.|..::..||..:|:.||.|::..|:|:|.::.||:|||
 Worm     3 LRSRVIDLYKNLYHMGKEYPG--GSKWFHDRLKLAFSKNKEVQDSKQVEQLIARGEFVVKEIEAL 65

  Fly    69 YSLKKYRSVKQRYSYND 85
            |||:|||::||||...|
 Worm    66 YSLRKYRAMKQRYYDKD 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR_ETFRF1_LYRM5 5..80 CDD:380760 36/74 (49%)
Y42A5A.5NP_001024237.2 Complex1_LYR 5..61 CDD:283097 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160159
Domainoid 1 1.000 48 1.000 Domainoid score I8038
eggNOG 1 0.900 - - E1_2CK7Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3730
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53295
OrthoDB 1 1.010 - - D1606295at2759
OrthoFinder 1 1.000 - - FOG0006215
OrthoInspector 1 1.000 - - oto19116
orthoMCL 1 0.900 - - OOG6_105048
Panther 1 1.100 - - LDO PTHR21024
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4044
SonicParanoid 1 1.000 - - X4490
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.