DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6115 and Y42A5A.5

DIOPT Version :8

Sequence 1:NP_001286001.1 Gene:CG6115 / 50459 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001024237.2 Gene:Y42A5A.5 / 3565757 WormBaseID:WBGene00012780 Length:99 Species:Caenorhabditis elegans

Alignment Length:82 Identity:41/83 (49%)
Similarity:61/83 (73%) Gaps:2/83 (2%)


  Fly     4 LRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVEAL 68
            |||:||.|||:|.::|:||||  |.:.|..::..||..:|:.||.|::..|:|:|.::.||:|||
 Worm     3 LRSRVIDLYKNLYHMGKEYPG--GSKWFHDRLKLAFSKNKEVQDSKQVEQLIARGEFVVKEIEAL 65

  Fly    69 YSLKKYRSVKQRYSYND 85
            |||:|||::||||...|
 Worm    66 YSLRKYRAMKQRYYDKD 82

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR 7..59 CDD:310152 22/52 (42%)
Y42A5A.5NP_001024237.2 Complex1_LYR 5..61 CDD:283097 24/58 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243454843
eggNOG 1 0.900 E1_2CK7Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3695
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1606295at2759
OrthoFinder 1 1.000 FOG0005039
OrthoInspector 1 1.000 T477465
orthoMCL 1 0.900 OOG5_132226
Panther 1 1.100 LDO PTHR21024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4044
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.