DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6115 and ETFRF1

Sequence 1:NP_001286001.1 Gene:CG6115 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001001660.2 Gene:ETFRF1 HGNCID:27052 Length:90 Species:Homo sapiens

Alignment Length:84 Identity:42/85 (49%)
Similarity:64/85 (75%) Gaps:3/85 (4%)


  Fly     2 SQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVE 66
            :.||.:|:.|||:|.||||:||  .|...|:|::.:.|:.:||.::|:||..|:|||.::.||:|
Human     5 NSLRGEVLKLYKNLLYLGRDYP--KGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELE 67

  Fly    67 ALYSLKKYRSVKQRYSYND 85
            |||.|:|||::|||| |:|
Human    68 ALYFLRKYRAMKQRY-YSD 85

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6115NP_001286001.1 Complex1_LYR 7..59 CDD:310152 24/52 (46%)
ETFRF1NP_001001660.2 Complex1_LYR <30..65 CDD:322931 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C243457245
eggNOG 1 0.900 E1_2CK7Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5066
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1606295at2759
OrthoFinder 1 1.000 FOG0005039
OrthoInspector 1 1.000 T1074271
orthoMCL 1 0.900 OOG5_132226
Panther 1 1.100 LDO PTHR21024
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4044
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.