DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osi and ETFRF1

DIOPT Version :10

Sequence 1:NP_652578.1 Gene:osi / 50459 FlyBaseID:FBgn0040985 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001001660.2 Gene:ETFRF1 / 144363 HGNCID:27052 Length:90 Species:Homo sapiens


Alignment Length:84 Identity:42/84 - (50%)
Similarity:64/84 - (76%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SQLRSKVISLYKHLQYLGREYPGLNGPQKFRKQIHDAFMNHKDEQDPKKIVALLAQGRYLAKEVE 66
            :.||.:|:.|||:|.||||:||  .|...|:|::.:.|:.:||.::|:||..|:|||.::.||:|
Human     5 NSLRGEVLKLYKNLLYLGRDYP--KGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELE 67

  Fly    67 ALYSLKKYRSVKQRYSYND 85
            |||.|:|||::|||| |:|
Human    68 ALYFLRKYRAMKQRY-YSD 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
osiNP_652578.1 Complex1_LYR_ETFRF1_LYRM5 5..80 CDD:380760 36/74 (49%)
ETFRF1NP_001001660.2 Complex1_LYR_ETFRF1_LYRM5 22..81 CDD:380760 28/60 (47%)

Return to query results.
Submit another query.