DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and sdhaf4

DIOPT Version :8

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001025355.1 Gene:sdhaf4 / 563956 ZFINID:ZDB-GENE-040724-116 Length:107 Species:Danio rerio

Alignment Length:94 Identity:36/95 (38%)
Similarity:43/95 (45%) Gaps:25/95 (26%)


  Fly    56 SKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKP-----------------------WPNNTN 97
            |:|  .|.|...:.|.|.|....:.....:|||||.                       :|::.|
Zfish    16 SRR--VFLESTMNTAGLRPAGYASGGVTKDKEPLKKAKTPQGRFDMEETESKSKDVLERFPDDVN 78

  Fly    98 PYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            |.|.|.||..|||||||||||||||..||
Zfish    79 PETKEKGGPRGPEPTRYGDWERKGRCIDF 107

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 28/68 (41%)
sdhaf4NP_001025355.1 DUF1674 <72..107 CDD:285179 23/35 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136198727
eggNOG 1 0.900 E1_KOG3245
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1530126at2759
OrthoFinder 1 1.000 FOG0003299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR28524
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.