DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and sdhaf4

DIOPT Version :9

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis

Alignment Length:123 Identity:41/123 - (33%)
Similarity:52/123 - (42%) Gaps:43/123 - (34%)


  Fly     4 SCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREKLRS 68
            ||||| |....|           |:|          ..:|.::.|..|:.|.             
 Frog    39 SCRAL-SHNSQH-----------NIK----------GTKQPLKKPTTPQGKF------------- 68

  Fly    69 EAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
                    :.:.....||.||:.:|::.||.|.|.||..|||||||||||||||..||
 Frog    69 --------DDSEQTTLEKNPLEKFPDDINPVTKEKGGPRGPEPTRYGDWERKGRCIDF 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 26/44 (59%)
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723 26/41 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 68 1.000 Domainoid score I9574
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1530126at2759
OrthoFinder 1 1.000 - - FOG0003611
OrthoInspector 1 1.000 - - otm48196
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.