DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and sdhaf4

DIOPT Version :8

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001008179.1 Gene:sdhaf4 / 493541 XenbaseID:XB-GENE-1007482 Length:118 Species:Xenopus tropicalis

Alignment Length:123 Identity:41/123 - (33%)
Similarity:52/123 - (42%) Gaps:43/123 - (34%)


  Fly     4 SCRALISQCGLHLRRCSLAKAASNLKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREKLRS 68
            ||||| |....|           |:|          ..:|.::.|..|:.|.             
 Frog    39 SCRAL-SHNSQH-----------NIK----------GTKQPLKKPTTPQGKF------------- 68

  Fly    69 EAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
                    :.:.....||.||:.:|::.||.|.|.||..|||||||||||||||..||
 Frog    69 --------DDSEQTTLEKNPLEKFPDDINPVTKEKGGPRGPEPTRYGDWERKGRCIDF 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 26/44 (59%)
sdhaf4NP_001008179.1 DUF1674 76..118 CDD:311723 26/41 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136200880
eggNOG 1 0.900 E1_KOG3245
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1530126at2759
OrthoFinder 1 1.000 FOG0003299
OrthoInspector 1 1.000 T601693
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.710

Return to query results.
Submit another query.