DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and Sirup

DIOPT Version :8

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_001285734.1 Gene:Sirup / 34089 FlyBaseID:FBgn0031971 Length:118 Species:Drosophila melanogaster

Alignment Length:126 Identity:64/127 (50%)
Similarity:78/127 (61%) Gaps:15/127 (12%)


  Fly     3 RSCRALISQCGLHLRRCSLAKA--ASNLKKDDVEEMETPANRQRVELPPNPEEKLSKRYLAFREK 65
            |....::.|.|..:...|.:.|  |:....|.|.|::.|..|         .|||    :||::|
  Fly     6 RQTARVLPQMGKQVSYLSTSGAWRATASGGDMVVEIKEPKTR---------TEKL----MAFQKK 57

  Fly    66 LRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            ||::.||..|.|.:.||..||||||||||.||||||||||.|||||||||||||||||:||
  Fly    58 LRAKTPLGKLDEFSRHPYQEKEPLKPWPNQTNPYTGEIGGPAGPEPTRYGDWERKGRVSDF 118

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 40/45 (89%)
SirupNP_001285734.1 DUF1674 73..118 CDD:285179 40/45 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135946129
eggNOG 1 0.900 E1_KOG3245
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I3719
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1530126at2759
OrthoFinder 1 1.000 FOG0003299
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR28524
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.