DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and W02D3.12

DIOPT Version :8

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_740875.1 Gene:W02D3.12 / 259380 WormBaseID:WBGene00020937 Length:89 Species:Caenorhabditis elegans

Alignment Length:87 Identity:36/88 (41%)
Similarity:48/88 (55%) Gaps:9/88 (10%)


  Fly    40 ANRQRVELPPNPEEKLSKRYLAFREKLRSEAPLEPLPECAPHPAHEKEPLKPWPNNTNPYTGEIG 104
            ::|:..::.|....|         ||:.:|...:...:.|....:|...||..|...|..|||:|
 Worm    12 SSRRFADIKPKQSAK---------EKVMAEKTPKGALDKADEQQYEDPHLKKHPGGVNKSTGEVG 67

  Fly   105 GQAGPEPTRYGDWERKGRVTDF 126
            |.|||||||||||||||||:||
 Worm    68 GPAGPEPTRYGDWERKGRVSDF 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 28/45 (62%)
W02D3.12NP_740875.1 DUF1674 48..89 CDD:285179 28/41 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C135946159
eggNOG 1 0.900 E1_KOG3245
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I3719
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1530126at2759
OrthoFinder 1 1.000 FOG0003299
OrthoInspector 1 1.000 T375316
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR28524
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
109.860

Return to query results.
Submit another query.