DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and SDHAF4

DIOPT Version :10

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:XP_047274166.1 Gene:SDHAF4 / 135154 HGNCID:20957 Length:111 Species:Homo sapiens


Alignment Length:45 Identity:16/45 - (35%)
Similarity:20/45 - (44%) Gaps:14/45 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LPE---CAPHPAH-EKEPLK--------PWPNNTNP--YTGEIGG 105
            |||   .||..:| |||||:        .|.....|  :..|:||
Human    53 LPEGRFDAPEDSHLEKEPLENLSFAGRMSWLITVIPAFWKAEVGG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:429724 11/36 (31%)
SDHAF4XP_047274166.1 None

Return to query results.
Submit another query.