DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15283 and SDHAF4

DIOPT Version :8

Sequence 1:NP_652574.3 Gene:CG15283 / 50454 FlyBaseID:FBgn0028844 Length:126 Species:Drosophila melanogaster
Sequence 2:NP_660310.2 Gene:SDHAF4 / 135154 HGNCID:20957 Length:108 Species:Homo sapiens

Alignment Length:56 Identity:35/57 (61%)
Similarity:40/57 (70%) Gaps:4/57 (7%)


  Fly    75 LPE---CAPHPAH-EKEPLKPWPNNTNPYTGEIGGQAGPEPTRYGDWERKGRVTDF 126
            |||   .||..:| |||||:.:|::.||.|.|.||..|||||||||||||||..||
Human    53 LPEGRFDAPEDSHLEKEPLEKFPDDVNPVTKEKGGPRGPEPTRYGDWERKGRCIDF 108

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15283NP_652574.3 DUF1674 81..126 CDD:285179 29/46 (63%)
SDHAF4NP_660310.2 DUF1674 66..108 CDD:311723 28/42 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C136202244
eggNOG 1 0.900 E1_KOG3245
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5212
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1530126at2759
OrthoFinder 1 1.000 FOG0003299
OrthoInspector 1 1.000 T609841
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR28524
Phylome 1 0.910 0.875 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.860

Return to query results.
Submit another query.