DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and F29G6.1

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:NP_509920.3 Gene:F29G6.1 / 181339 WormBaseID:WBGene00009257 Length:1189 Species:Caenorhabditis elegans


Alignment Length:56 Identity:19/56 - (33%)
Similarity:28/56 - (50%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSEGSYC--PCDLKTKGTQVCGSNGVTFKNRCEFECSQRDYKKLGRTLNIRKDGPC 73
            |.:|..|  |||  ...|.||... :|..|.|.|..:|.:.:::.:||:|...|.|
 Worm   983 SYQGQCCNQPCD--EDKTPVCDGT-ITHPNICRFRIAQCEAERVNKTLSIAYSGEC 1035

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052 11/35 (31%)
F29G6.1NP_509920.3 KAZAL_FS 40..79 CDD:238052
Kazal_2 133..176 CDD:400135
KAZAL 274..320 CDD:197624
Kazal_2 325..376 CDD:400135
KAZAL 389..>424 CDD:197624
KAZAL 550..599 CDD:197624
KAZAL 605..648 CDD:197624
KAZAL 786..832 CDD:197624
KAZAL 833..881 CDD:197624
KAZAL 886..937 CDD:197624
KAZAL 941..988 CDD:197624 2/4 (50%)
KAZAL 1092..1138 CDD:197624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.