DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14933 and SPINK13

DIOPT Version :10

Sequence 1:NP_652566.1 Gene:CG14933 / 50442 FlyBaseID:FBgn0040968 Length:77 Species:Drosophila melanogaster
Sequence 2:XP_047272756.1 Gene:SPINK13 / 153218 HGNCID:27200 Length:114 Species:Homo sapiens


Alignment Length:38 Identity:15/38 - (39%)
Similarity:20/38 - (52%) Gaps:3/38 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VCGSNGVTFKNRCEFECSQRDYKKLGRTLNIRKDGPCN 74
            ||.|||.||:|.|.|...||::.   ..:...|.|.|:
Human    80 VCASNGHTFQNECFFCVEQREFH---YRIKFEKYGKCD 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14933NP_652566.1 KAZAL_FS 37..73 CDD:238052 14/35 (40%)
SPINK13XP_047272756.1 KAZAL_FS 73..113 CDD:238052 14/35 (40%)

Return to query results.
Submit another query.