DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32983 and CG32987

Sequence 1:NP_788009.1 Gene:CG32983 FlyBaseID:FBgn0052983 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_788007.1 Gene:CG32987 FlyBaseID:FBgn0052987 Length:257 Species:Drosophila melanogaster

Alignment Length:216 Identity:69/217 (32%)
Similarity:115/217 (53%) Gaps:18/217 (8%)


  Fly    22 FARTVYIEAVLLCSASAFPLMFIASLKISIVRILPVPPYVWLLFALAILAVLICLP-ISRVRPLI 85
            |.|::|...::|...:....:.:....|.:.|.||.|.||..|....::..:.|:| ||...| .
  Fly    23 FIRSIYNIGLILIGITVGAWILLMLTHIHLQRYLPFPCYVLALIIFLVMICMHCIPRISYYSP-C 86

  Fly    86 VWTMVGGVVGLLTLSAAYYVNMYDIPDLVLYFTV--MALVLGGLMFSGAKCRKSFLPNGLVTGVI 148
            .|.|.|.||...||...:::  :|:..|::.|.:  :||::..|.||||.|.:.|||.    ||.
  Fly    87 KWFMTGLVVVCTTLFGCHFI--HDLSPLIISFVMIGVALIIMLLNFSGAMCPQEFLPG----GVC 145

  Fly   149 VTIFLVA-LLPLSVLSVV----STRYFFPTFCAVLSALVLIVIPLEAQFMHGRLQYSPLGLEP-- 206
            .|:.::| ||.|:::.:|    .:.....||.::|..:::|.||::|||.||||....:..|.  
  Fly   146 STLLMMALLLVLTIVGIVQLCTGSVELLDTFVSILFLMLIIAIPIQAQFNHGRLNVVEVVPEEHL 210

  Fly   207 -ICSMLIYLNSFTLFFCICVF 226
             :|::.:||:|...|||:|.|
  Fly   211 MVCTLTLYLHSMMFFFCVCYF 231



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131301652
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.