DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32983 and ZC13.2

Sequence 1:NP_788009.1 Gene:CG32983 FlyBaseID:FBgn0052983 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_508172.1 Gene:ZC13.2 WormBaseID:WBGene00022503 Length:321 Species:Caenorhabditis elegans

Alignment Length:235 Identity:44/236 (19%)
Similarity:82/236 (35%) Gaps:87/236 (37%)


  Fly    17 EVQLVFARTVYIEAV-LLCSASAFPLMFIASLKISIVRILPVPPYV-------WL---LFALAIL 70
            |:..::..:..:|.| ||..:|..|.:|:.:....|.:: |:...:       ||   ..:..:.
 Worm   112 EIPYLYNDSADVETVNLLLDSSGVPDIFMENASFGIEQV-PMTTVIIGDIEFDWLEVIRISTIVY 175

  Fly    71 AVLICLPISRVRPLIVWTMVGGVVGLLTLSAAYYVNMYDIPDLVLYFTVMALVLGGLMFSGAKCR 135
            .|:||.          | ...||..:.|:..       ::.|..::.|.:.:::  ::|..|.. 
 Worm   176 LVIICF----------W-FGSGVFFIFTIRC-------EVLDTAIFNTTILILV--VLFQIAHA- 219

  Fly   136 KSFLPNGLVTGVI------------VTIFLVALLPLSVLSVVSTRYFFPTFCAVLSALVLIVIPL 188
                  ||||.:|            :||..:.:|                ||......|.|.:..
 Worm   220 ------GLVTSLIFFQREMSWRTLSITIGTIVIL----------------FCCAFLGFVCITLNC 262

  Fly   189 ----EAQFMHGRLQYSPLGLEPICSMLIYLNSFTLFFCIC 224
                ...:|||:.:.|      |||:          |.:|
 Worm   263 GWVKYIDYMHGKKKCS------ICSL----------FSLC 286



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131301748
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.890

Return to query results.
Submit another query.