DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sem1 and DSS1(V)

DIOPT Version :8

Sequence 1:NP_652555.1 Gene:Sem1 / 50428 FlyBaseID:FBgn0266666 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_199314.1 Gene:DSS1(V) / 834532 AraportID:AT5G45010 Length:73 Species:Arabidopsis thaliana

Alignment Length:53 Identity:29/54 (54%)
Similarity:41/54 (76%) Gaps:2/54 (4%)


  Fly    24 LLEEDDEFEEFPA-EDFRVGDDEEELNV-WEDNWDDDNVEDDFSQQLKAHLES 74
            |.|:|||||||.. ||:...::.:|::: |||:||||:|.||||:|||..||:
plant    16 LFEDDDEFEEFEINEDWLEKEEVKEVSLQWEDDWDDDDVSDDFSRQLKKELEN 68

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Sem1NP_652555.1 DSS1_SEM1 <43..73 CDD:282950 17/31 (55%)
DSS1(V)NP_199314.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130158
Panther 1 1.100 O PTHR16771
Phylome 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.