DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15577 and CG15578

DIOPT Version :10

Sequence 1:NP_652513.1 Gene:CG15577 / 50378 FlyBaseID:FBgn0040904 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_652514.1 Gene:CG15578 / 50379 FlyBaseID:FBgn0040905 Length:89 Species:Drosophila melanogaster


Alignment Length:73 Identity:50/73 - (68%)
Similarity:60/73 - (82%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRRNDPEFYRQVQVNLRDGVEYGILK 73
            ||| :|:||||||:||:.|||.|.|||:|.|||..||.||:||||||:.|||:||.||:|..||:
  Fly     7 TLP-KRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDPEFFAQVQINLHDGIESAILR 70

  Fly    74 RQGNQFSL 81
            |||||.||
  Fly    71 RQGNQISL 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15577NP_652513.1 DUF4777 16..81 CDD:374290 44/64 (69%)
CG15578NP_652514.1 None

Return to query results.
Submit another query.