DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15577 and CG15578

DIOPT Version :8

Sequence 1:NP_652513.1 Gene:CG15577 / 50378 FlyBaseID:FBgn0040904 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_652514.1 Gene:CG15578 / 50379 FlyBaseID:FBgn0040905 Length:89 Species:Drosophila melanogaster

Alignment Length:73 Identity:50/74 (68%)
Similarity:60/74 (81%) Gaps:1/74 (1%)


  Fly     9 TLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRRNDPEFYRQVQVNLRDGVEYGILK 73
            ||| :|:||||||:||:.|||.|.|||:|.|||..||.||:||||||:.|||:||.||:|..||:
  Fly     7 TLP-KRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDPEFFAQVQINLHDGIESAILR 70

  Fly    74 RQGNQFSL 81
            |||||.||
  Fly    71 RQGNQISL 78

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15577NP_652513.1 DUF4777 24..81 CDD:292626 38/57 (67%)
CG15578NP_652514.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139742105
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.