DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and AT5G20165

DIOPT Version :8

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001318607.1 Gene:AT5G20165 / 832139 AraportID:AT5G20165 Length:91 Species:Arabidopsis thaliana

Alignment Length:72 Identity:32/73 (44%)
Similarity:41/73 (56%) Gaps:24/73 (33%)


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTG-----------------------FMGT 42
            |||||||||.|:|:||:||||.||:..||::::: |||                       |.|.
plant     1 MSALFNFHSFLTVVLLVICTCTYLKMQFPAILEQ-KTGIVFCQIKDALSDFSAYCYFRLQMFRGF 64

  Fly    43 FWKLARI 49
            |||.|||
plant    65 FWKAARI 71

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 13/48 (27%)
AT5G20165NP_001318607.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2504
OMA 1 1.010
OrthoDB 1 1.010 D1596132at2759
OrthoInspector 1 1.000 T193028
orthoMCL 1 0.900 OOG5_129312
Panther 1 1.100 LDO PTHR13229
Phylome 1 0.910 0.667 Consistency score
87.980

Return to query results.
Submit another query.