DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and AT5G20165

DIOPT Version :10

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001318607.1 Gene:AT5G20165 / 832139 AraportID:AT5G20165 Length:91 Species:Arabidopsis thaliana


Alignment Length:72 Identity:32/72 - (44%)
Similarity:41/72 - (56%) Gaps:24/72 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTG-----------------------FMGT 42
            |||||||||.|:|:||:||||.||:..||::::: |||                       |.|.
plant     1 MSALFNFHSFLTVVLLVICTCTYLKMQFPAILEQ-KTGIVFCQIKDALSDFSAYCYFRLQMFRGF 64

  Fly    43 FWKLARI 49
            |||.|||
plant    65 FWKAARI 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:462019 12/47 (26%)
AT5G20165NP_001318607.1 DUF1242 10..38 CDD:462019 14/28 (50%)

Return to query results.
Submit another query.