powered by:
Protein Alignment ksh and Tmem167b
DIOPT Version :8
Sequence 1: | NP_652499.2 |
Gene: | ksh / 50363 |
FlyBaseID: | FBgn0040890 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_080474.2 |
Gene: | Tmem167b / 67495 |
MGIID: | 1914745 |
Length: | 74 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 29/73 - (39%) |
Similarity: | 41/73 - (56%) |
Gaps: | 4/73 - (5%) |
Fly 1 MSALFNFHSLLSVILLLICTCAYLRSLFPSL---IDRNKTGFMGTFWKLARIGERKSPWVGAACL 62
|:.:::...:|...||.:|||||.:.: |.| :...|.|..|.|:|.|.||.|....|..||:
Mouse 1 MTNVYSLDGILVFGLLFVCTCAYFKKV-PRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACI 64
Fly 63 IMAFTVLF 70
:|||.|||
Mouse 65 VMAFYVLF 72
|
Known Domains:
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
|
|
|
E1_KOG3808 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.