DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and Tmem167b

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_080474.2 Gene:Tmem167b / 67495 MGIID:1914745 Length:74 Species:Mus musculus


Alignment Length:73 Identity:29/73 - (39%)
Similarity:41/73 - (56%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSL---IDRNKTGFMGTFWKLARIGERKSPWVGAACL 62
            |:.:::...:|...||.:|||||.:.: |.|   :...|.|..|.|:|.|.||.|....|..||:
Mouse     1 MTNVYSLDGILVFGLLFVCTCAYFKKV-PRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACI 64

  Fly    63 IMAFTVLF 70
            :|||.|||
Mouse    65 VMAFYVLF 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 10/27 (37%)
Tmem167bNP_080474.2 DUF1242 11..46 CDD:399673 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3808
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.