DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and Tmem167b

DIOPT Version :8

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_080474.2 Gene:Tmem167b / 67495 MGIID:1914745 Length:74 Species:Mus musculus

Alignment Length:73 Identity:29/74 (39%)
Similarity:41/74 (55%) Gaps:4/74 (5%)


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSL---IDRNKTGFMGTFWKLARIGERKSPWVGAACL 62
            |:.:::...:|...||.:|||||.:.: |.|   :...|.|..|.|:|.|.||.|....|..||:
Mouse     1 MTNVYSLDGILVFGLLFVCTCAYFKKV-PRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACI 64

  Fly    63 IMAFTVLF 70
            :|||.|||
Mouse    65 VMAFYVLF 72

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 11/28 (39%)
Tmem167bNP_080474.2 DUF1242 11..46 CDD:336521 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3808
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.