DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and tmem167a

DIOPT Version :10

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001016167.1 Gene:tmem167a / 548921 XenbaseID:XB-GENE-943966 Length:72 Species:Xenopus tropicalis


Alignment Length:70 Identity:50/70 - (71%)
Similarity:61/70 - (87%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
            |||:|||.|||.|||||||||||||:|.|:|:|:||||.:|.|||.|||||||||:|...|::||
 Frog     1 MSAIFNFQSLLIVILLLICTCAYLRALVPNLLDKNKTGILGIFWKCARIGERKSPYVAVCCVVMA 65

  Fly    66 FTVLF 70
            |::||
 Frog    66 FSILF 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:462019 16/24 (67%)
tmem167aNP_001016167.1 DUF1242 <19..44 CDD:462019 16/24 (67%)

Return to query results.
Submit another query.