DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and tmem167a

DIOPT Version :8

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001016167.1 Gene:tmem167a / 548921 XenbaseID:XB-GENE-943966 Length:72 Species:Xenopus tropicalis

Alignment Length:70 Identity:50/71 (70%)
Similarity:61/71 (86%) Gaps:0/71 (0%)


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
            |||:|||.|||.|||||||||||||:|.|:|:|:||||.:|.|||.|||||||||:|...|::||
 Frog     1 MSAIFNFQSLLIVILLLICTCAYLRALVPNLLDKNKTGILGIFWKCARIGERKSPYVAVCCVVMA 65

  Fly    66 FTVLF 70
            |::||
 Frog    66 FSILF 70

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 17/25 (68%)
tmem167aNP_001016167.1 DUF1242 <19..44 CDD:311039 17/25 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C227957634
eggNOG 1 0.900 E1_KOG3808
Hieranoid 1 1.000
Homologene 1 1.000 H41626
Inparanoid 1 1.050 112 1.000 Inparanoid score I4613
OMA 1 1.010
OrthoDB 1 1.010 D1596132at2759
OrthoFinder 1 1.000 FOG0004443
OrthoInspector 1 1.000 T1061095
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R639
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.