powered by:
Protein Alignment ksh and tmem167a
DIOPT Version :9
| Sequence 1: | NP_652499.2 |
Gene: | ksh / 50363 |
FlyBaseID: | FBgn0040890 |
Length: | 72 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001016167.1 |
Gene: | tmem167a / 548921 |
XenbaseID: | XB-GENE-943966 |
Length: | 72 |
Species: | Xenopus tropicalis |
| Alignment Length: | 70 |
Identity: | 50/70 - (71%) |
| Similarity: | 61/70 - (87%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
|||:|||.|||.|||||||||||||:|.|:|:|:||||.:|.|||.|||||||||:|...|::||
Frog 1 MSAIFNFQSLLIVILLLICTCAYLRALVPNLLDKNKTGILGIFWKCARIGERKSPYVAVCCVVMA 65
Fly 66 FTVLF 70
|::||
Frog 66 FSILF 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
1 |
1.000 |
61 |
1.000 |
Domainoid score |
I10362 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
1 |
1.000 |
- |
- |
|
H41626 |
| Inparanoid |
1 |
1.050 |
112 |
1.000 |
Inparanoid score |
I4728 |
| OMA |
1 |
1.010 |
- |
- |
|
QHG53568 |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1596132at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001976 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto103474 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13229 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R639 |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X3223 |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
12 | 12.110 |
|
Return to query results.
Submit another query.