DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and tmem167b

DIOPT Version :8

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001003761.1 Gene:tmem167b / 445304 ZFINID:ZDB-GENE-040808-17 Length:74 Species:Danio rerio

Alignment Length:72 Identity:30/73 (41%)
Similarity:42/73 (58%) Gaps:2/73 (3%)


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSL--FPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLI 63
            |:.:::|..:|...||.|||||||:.:  ..|.:...|.|..|.|:|.|.||.|....|.|:||.
Zfish     1 MTNVYSFDGILVFGLLFICTCAYLKKVPRLNSWLLSEKKGVWGVFYKAAVIGTRLHVVVAASCLC 65

  Fly    64 MAFTVLF 70
            |||.::|
Zfish    66 MAFYLIF 72

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 11/27 (41%)
tmem167bNP_001003761.1 DUF1242 11..46 CDD:284305 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3808
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1596132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.700 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.