DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and LOC108349010

DIOPT Version :8

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:XP_017443492.1 Gene:LOC108349010 / 108349010 RGDID:11454336 Length:74 Species:Rattus norvegicus

Alignment Length:73 Identity:29/74 (39%)
Similarity:41/74 (55%) Gaps:4/74 (5%)


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSL---IDRNKTGFMGTFWKLARIGERKSPWVGAACL 62
            |:.:::...:|...||.:|||||.:.: |.|   :...|.|..|.|:|.|.||.|....|..||:
  Rat     1 MTNVYSLDGILVFGLLFVCTCAYFKKV-PRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACI 64

  Fly    63 IMAFTVLF 70
            :|||.|||
  Rat    65 VMAFYVLF 72

Known Domains:


GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 11/28 (39%)
LOC108349010XP_017443492.1 DUF1242 11..46 CDD:336521 14/36 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3808
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1596132at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.812 Consistency score
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.