DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG13051

DIOPT Version :8

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster

Alignment Length:107 Identity:60/108 (56%)
Similarity:65/108 (60%) Gaps:34/108 (31%)


  Fly     1 MFKFFAVALFALIACVAAKPGIVAPLAYSAPLVAAAPAAAVYSREYHGNFAAPYVASPYVASPYV 65
            ||||.|..:|||.||||||||||||||||                      ||||||||||||||
  Fly     1 MFKFVAAVIFALFACVAAKPGIVAPLAYS----------------------APYVASPYVASPYV 43

  Fly    66 ASPYVASPYV-------ASPYV---ASPYVAAPYTAPLLLKK 97
            ||||||:||.       |:||.   .:||.|  ||:||||||
  Fly    44 ASPYVAAPYTAAYTAAYAAPYTTAYTAPYAA--YTSPLLLKK 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 30/50 (60%)
CG13051NP_001097618.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134667039
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011440
orthoMCL 1 0.900 OOG5_154995
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.