DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG14096

DIOPT Version :8

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster

Alignment Length:118 Identity:51/119 (43%)
Similarity:65/119 (55%) Gaps:28/119 (24%)


  Fly     1 MFKFFAVALFALIACVAAKPGIV-------APLAYSAPLVAAAPAAA--------------VYSR 44
            ||| .||.:.|::||.|||||::       |||||||||..:||||.              |.:|
  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64

  Fly    45 EYHGNFAAPYVASPYVASPYVASPYVASPYV-ASPYVASPYVAAPYTAPLLLK 96
            .|:|...||.:|.  ||:|.||. |.|:|:. |||...|..:|  ||:||..|
  Fly    65 NYNGIAVAPVIAP--VAAPVVAK-YTAAPFAYASPLAYSAPLA--YTSPLAYK 112

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 18/41 (44%)
CG14096NP_649113.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.