DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG13678

DIOPT Version :9

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_648193.1 Gene:CG13678 / 38922 FlyBaseID:FBgn0035859 Length:128 Species:Drosophila melanogaster


Alignment Length:131 Identity:59/131 - (45%)
Similarity:73/131 - (55%) Gaps:37/131 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFFAVALFALIACVAAKPGIV-----APLAYSAPLVA-----AAPAAAVY-------SREYHG 48
            ||||.|: .||::|..||||||:     |||||:||.|.     .||.|:.|       |..:..
  Fly     1 MFKFAAI-FFAVVAVAAAKPGILAPLAAAPLAYTAPAVVGSAAYVAPYASSYTAHSVAHSAAFPA 64

  Fly    49 NFAAPYVASPY---VASPYVA---SPYV--ASPYVA---------SPYVASPYVAAPYTAPLLLK 96
            ::||| ||:.|   :|:|..|   :||.  |:||.|         |||||.|||||. .||||||
  Fly    65 SYAAP-VAAAYTAPIAAPLAAAYTAPYTRFATPYAAAYTSPLAYSSPYVARPYVAAA-AAPLLLK 127

  Fly    97 K 97
            |
  Fly   128 K 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 24/56 (43%)
CG13678NP_648193.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.