DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG32266

DIOPT Version :8

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_728900.1 Gene:CG32266 / 317945 FlyBaseID:FBgn0052266 Length:77 Species:Drosophila melanogaster

Alignment Length:79 Identity:32/80 (40%)
Similarity:43/80 (54%) Gaps:9/80 (11%)


  Fly     1 MFKFFAVALFALIACVAAKPGIVAPLAYSAPLVAAAPAAAVYSREYHGNFAAPYVASPYVASPYV 65
            ||||||:.||||:|....||..:...:.::|:|||.|.|      |.|...||..::.|.:..|.
  Fly     1 MFKFFALCLFALLAVACGKPQFLTAYSAASPVVAATPYA------YSGGLYAPTYSAAYTSGVYA 59

  Fly    66 ASPYVASPYVASPY 79
            |:||.   |.|.||
  Fly    60 ATPYA---YGAYPY 70

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 11/29 (38%)
CG32266NP_728900.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0011440
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.