DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13066 and CG14096

DIOPT Version :9

Sequence 1:NP_652417.2 Gene:CG13066 / 50270 FlyBaseID:FBgn0040797 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster


Alignment Length:118 Identity:49/118 - (41%)
Similarity:58/118 - (49%) Gaps:38/118 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVVLCALFAAAAANPGL----LAYNAPLAYSTPLAYSSLPAA-----APLAYTA----------- 50
            |||:.|:.|.|||.|||    |||.||||||.|||||: |||     ||:. ||           
  Fly     5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSA-PAAVVAAPAPVV-TATSSQVIARNYN 67

  Fly    51 --AYTPAYAPYVAPYASSYSAHSVAHSAAL----------PAVY----AAAPV 87
              |..|..||..||..:.|:|...|:::.|          |..|    |||||
  Fly    68 GIAVAPVIAPVAAPVVAKYTAAPFAYASPLAYSAPLAYTSPLAYKTLPAAAPV 120



Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.