DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13066 and CG14096

DIOPT Version :8

Sequence 1:NP_652417.2 Gene:CG13066 / 50270 FlyBaseID:FBgn0040797 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster

Alignment Length:118 Identity:49/119 (41%)
Similarity:58/119 (49%) Gaps:38/119 (32%)


  Fly     6 AVVLCALFAAAAANPGL----LAYNAPLAYSTPLAYSSLPAA-----APLAYTA----------- 50
            |||:.|:.|.|||.|||    |||.||||||.|||||: |||     ||:. ||           
  Fly     5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSA-PAAVVAAPAPVV-TATSSQVIARNYN 67

  Fly    51 --AYTPAYAPYVAPYASSYSAHSVAHSAAL----------PAVY----AAAPV 87
              |..|..||..||..:.|:|...|:::.|          |..|    |||||
  Fly    68 GIAVAPVIAPVAAPVVAKYTAAPFAYASPLAYSAPLAYTSPLAYKTLPAAAPV 120



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.