DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13066 and CG14096

DIOPT Version :10

Sequence 1:NP_652417.2 Gene:CG13066 / 50270 FlyBaseID:FBgn0040797 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_649113.1 Gene:CG14096 / 40113 FlyBaseID:FBgn0036871 Length:122 Species:Drosophila melanogaster


Alignment Length:118 Identity:49/118 - (41%)
Similarity:58/118 - (49%) Gaps:38/118 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AVVLCALFAAAAANPGL----LAYNAPLAYSTPLAYSSLPAA-----APLAYTA----------- 50
            |||:.|:.|.|||.|||    |||.||||||.|||||: |||     ||:. ||           
  Fly     5 AVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSA-PAAVVAAPAPVV-TATSSQVIARNYN 67

  Fly    51 --AYTPAYAPYVAPYASSYSAHSVAHSAAL----------PAVY----AAAPV 87
              |..|..||..||..:.|:|...|:::.|          |..|    |||||
  Fly    68 GIAVAPVIAPVAAPVVAKYTAAPFAYASPLAYSAPLAYTSPLAYKTLPAAAPV 120

Return to query results.
Submit another query.