DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13066 and CG13674

DIOPT Version :8

Sequence 1:NP_652417.2 Gene:CG13066 / 50270 FlyBaseID:FBgn0040797 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001261570.1 Gene:CG13674 / 38921 FlyBaseID:FBgn0035858 Length:137 Species:Drosophila melanogaster

Alignment Length:90 Identity:45/91 (49%)
Similarity:50/91 (55%) Gaps:23/91 (25%)


  Fly     2 MKFFAVVLCALFAAAAANPGLLAYNAPLAYSTPLAYSSLPAAAPLAYTAAYTPAYAPYVAPYASS 66
            |||.||...|:.|.|||.||::                    |||||||......|.||||||||
  Fly     1 MKFLAVCFFAVVAVAAAKPGIV--------------------APLAYTAPAVVGSAAYVAPYASS 45

  Fly    67 YSAHSVAHSAALPAVYAA---APVA 88
            |:|:|||||||.||.|.|   ||||
  Fly    46 YTANSVAHSAAFPAAYTAAYTAPVA 70



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2CJIV
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR35685
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.