DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13056 and CG34268

DIOPT Version :8

Sequence 1:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_001097465.1 Gene:CG34268 / 5740141 FlyBaseID:FBgn0085297 Length:83 Species:Drosophila melanogaster

Alignment Length:91 Identity:23/92 (25%)
Similarity:42/92 (46%) Gaps:11/92 (12%)


  Fly     5 MYLSFALLLCLLALGNADLQLYHP---LMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRSVPR 66
            |:...|::..|:|:..|......|   ::.:.......|...:|:||| .|.|   ..|.::||.
  Fly     1 MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVKHVP-VVQH---VPVVKNVPV 61

  Fly    67 TTSLLTPALRSTYLNYPTWGYPLFDG 92
            ...:  |.|:|..:  ||:|:.::.|
  Fly    62 VQHV--PVLKSYAV--PTYGHHIYHG 83

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13056NP_652414.2 Retinin_C 34..>83 CDD:282395 13/49 (27%)
CG34268NP_001097465.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR34931
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.