DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13056 and CG13041

DIOPT Version :10

Sequence 1:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster


Alignment Length:79 Identity:28/79 - (35%)
Similarity:44/79 - (55%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MYLSFALLLCLLALGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTS 69
            |:...|::..|:|..:|.|...|.::   |.|..||||.:|...|:||||||.|.|| |......
  Fly     1 MFKFVAVIALLVATASAGLIETHHVV---HEPVLAKVGSVVHSAPSAVSHQSITQVH-SKAVVQP 61

  Fly    70 LLTPALRSTYLNYP 83
            ::.|.:::|..::|
  Fly    62 VVAPIVKTTTYSHP 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13056NP_652414.2 Retinin_C 34..83 CDD:427994 20/48 (42%)
CG13041NP_648872.1 Retinin_C 25..>73 CDD:427994 20/51 (39%)

Return to query results.
Submit another query.