DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13056 and CG13041

DIOPT Version :9

Sequence 1:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_648872.1 Gene:CG13041 / 39801 FlyBaseID:FBgn0036605 Length:124 Species:Drosophila melanogaster


Alignment Length:79 Identity:28/79 - (35%)
Similarity:44/79 - (55%) Gaps:4/79 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MYLSFALLLCLLALGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTS 69
            |:...|::..|:|..:|.|...|.::   |.|..||||.:|...|:||||||.|.|| |......
  Fly     1 MFKFVAVIALLVATASAGLIETHHVV---HEPVLAKVGSVVHSAPSAVSHQSITQVH-SKAVVQP 61

  Fly    70 LLTPALRSTYLNYP 83
            ::.|.:::|..::|
  Fly    62 VVAPIVKTTTYSHP 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13056NP_652414.2 Retinin_C 34..>83 CDD:282395 20/48 (42%)
CG13041NP_648872.1 Retinin_C 25..>73 CDD:282395 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR34931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.