DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13056 and LOC1276816

DIOPT Version :10

Sequence 1:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster
Sequence 2:XP_316208.3 Gene:LOC1276816 / 1276816 VectorBaseID:AGAMI1_012964 Length:128 Species:Anopheles gambiae


Alignment Length:72 Identity:30/72 - (41%)
Similarity:43/72 - (59%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LALGNADL----QLYHPLMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTSLLTPALR 76
            ||...|.|    ::|:. .::...||.|.||.||:.:||||||||||:||.|...|..:..||::
Mosquito    27 LAYAPATLIAKPEIYYQ-KSIIEEPTVAHVGSLVKTIPTAVSHQSSTVVHNSAKITEPIYAPAVK 90

  Fly    77 STYLNYP 83
            .|.::.|
Mosquito    91 QTLVSTP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13056NP_652414.2 Retinin_C 34..83 CDD:427994 24/48 (50%)
LOC1276816XP_316208.3 Retinin_C 46..103 CDD:427994 25/52 (48%)

Return to query results.
Submit another query.