DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13056 and AgaP_AGAP006148

DIOPT Version :9

Sequence 1:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster
Sequence 2:XP_316208.3 Gene:AgaP_AGAP006148 / 1276816 VectorBaseID:AGAP006148 Length:128 Species:Anopheles gambiae


Alignment Length:72 Identity:30/72 - (41%)
Similarity:43/72 - (59%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LALGNADL----QLYHPLMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTSLLTPALR 76
            ||...|.|    ::|:. .::...||.|.||.||:.:||||||||||:||.|...|..:..||::
Mosquito    27 LAYAPATLIAKPEIYYQ-KSIIEEPTVAHVGSLVKTIPTAVSHQSSTVVHNSAKITEPIYAPAVK 90

  Fly    77 STYLNYP 83
            .|.::.|
Mosquito    91 QTLVSTP 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13056NP_652414.2 Retinin_C 34..>83 CDD:282395 24/48 (50%)
AgaP_AGAP006148XP_316208.3 Retinin_C 46..103 CDD:282395 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR34931
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.060

Return to query results.
Submit another query.