powered by:
Protein Alignment CG13056 and AgaP_AGAP006148
DIOPT Version :9
Sequence 1: | NP_652414.2 |
Gene: | CG13056 / 50267 |
FlyBaseID: | FBgn0040794 |
Length: | 99 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_316208.3 |
Gene: | AgaP_AGAP006148 / 1276816 |
VectorBaseID: | AGAP006148 |
Length: | 128 |
Species: | Anopheles gambiae |
Alignment Length: | 72 |
Identity: | 30/72 - (41%) |
Similarity: | 43/72 - (59%) |
Gaps: | 5/72 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 LALGNADL----QLYHPLMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTSLLTPALR 76
||...|.| ::|:. .::...||.|.||.||:.:||||||||||:||.|...|..:..||::
Mosquito 27 LAYAPATLIAKPEIYYQ-KSIIEEPTVAHVGSLVKTIPTAVSHQSSTVVHNSAKITEPIYAPAVK 90
Fly 77 STYLNYP 83
.|.::.|
Mosquito 91 QTLVSTP 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR34931 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 2.060 |
|
Return to query results.
Submit another query.