DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox7c

DIOPT Version :9

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_956289.1 Gene:cox7c / 336118 ZFINID:ZDB-GENE-030131-8062 Length:63 Species:Danio rerio


Alignment Length:66 Identity:29/66 - (43%)
Similarity:42/66 - (63%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |||::   .|.|:.|.||.|.:...||:||||.:.||:|:..:..:....||..||::||||:||
Zfish     1 MLGQA---VRRFATSAVRSSHYAEGPGKNLPFSVENKWRLLGMMVLFFGSGFAFPFIVVRHQILK 62

  Fly    66 K 66
            |
Zfish    63 K 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 18/44 (41%)
cox7cNP_956289.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581938
Domainoid 1 1.000 55 1.000 Domainoid score I11145
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5420
OMA 1 1.010 - - QHG46321
OrthoDB 1 1.010 - - D1642074at2759
OrthoFinder 1 1.000 - - FOG0006931
OrthoInspector 1 1.000 - - oto41391
orthoMCL 1 0.900 - - OOG6_106540
Panther 1 1.100 - - LDO PTHR13313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5099
SonicParanoid 1 1.000 - - X5025
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.