powered by:
Protein Alignment COX7C and cox7c
DIOPT Version :9
| Sequence 1: | NP_001286268.1 |
Gene: | COX7C / 50246 |
FlyBaseID: | FBgn0040773 |
Length: | 66 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_956289.1 |
Gene: | cox7c / 336118 |
ZFINID: | ZDB-GENE-030131-8062 |
Length: | 63 |
Species: | Danio rerio |
| Alignment Length: | 66 |
Identity: | 29/66 - (43%) |
| Similarity: | 42/66 - (63%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
|||:: .|.|:.|.||.|.:...||:||||.:.||:|:..:..:....||..||::||||:||
Zfish 1 MLGQA---VRRFATSAVRSSHYAEGPGKNLPFSVENKWRLLGMMVLFFGSGFAFPFIVVRHQILK 62
Fly 66 K 66
|
Zfish 63 K 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C170581938 |
| Domainoid |
1 |
1.000 |
55 |
1.000 |
Domainoid score |
I11145 |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
1 |
1.000 |
- |
- |
|
|
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
1 |
1.050 |
58 |
1.000 |
Inparanoid score |
I5420 |
| OMA |
1 |
1.010 |
- |
- |
|
QHG46321 |
| OrthoDB |
1 |
1.010 |
- |
- |
|
D1642074at2759 |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006931 |
| OrthoInspector |
1 |
1.000 |
- |
- |
|
oto41391 |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_106540 |
| Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13313 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5099 |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X5025 |
| SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
14 | 13.940 |
|
Return to query results.
Submit another query.