DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox7c

DIOPT Version :10

Sequence 1:NP_652397.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_956289.1 Gene:cox7c / 336118 ZFINID:ZDB-GENE-030131-8062 Length:63 Species:Danio rerio


Alignment Length:66 Identity:29/66 - (43%)
Similarity:42/66 - (63%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |||::   .|.|:.|.||.|.:...||:||||.:.||:|:..:..:....||..||::||||:||
Zfish     1 MLGQA---VRRFATSAVRSSHYAEGPGKNLPFSVENKWRLLGMMVLFFGSGFAFPFIVVRHQILK 62

  Fly    66 K 66
            |
Zfish    63 K 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_652397.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 18/44 (41%)
cox7cNP_956289.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 18/44 (41%)

Return to query results.
Submit another query.