DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox7c

DIOPT Version :8

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_956289.1 Gene:cox7c / 336118 ZFINID:ZDB-GENE-030131-8062 Length:63 Species:Danio rerio

Alignment Length:66 Identity:29/67 (43%)
Similarity:42/67 (63%) Gaps:3/67 (4%)


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |||::   .|.|:.|.||.|.:...||:||||.:.||:|:..:..:....||..||::||||:||
Zfish     1 MLGQA---VRRFATSAVRSSHYAEGPGKNLPFSVENKWRLLGMMVLFFGSGFAFPFIVVRHQILK 62

  Fly    66 K 66
            |
Zfish    63 K 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 19/45 (42%)
cox7cNP_956289.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 19/45 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C288482224
eggNOG 1 0.900 E1_KOG4527
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5332
OMA 1 1.010
OrthoDB 1 1.010 D1642074at2759
OrthoFinder 1 1.000 FOG0005238
OrthoInspector 1 1.000 T1052335
orthoMCL 1 0.900 OOG5_134372
Panther 1 1.100 LDO PTHR13313
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5099
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.