DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox7c

DIOPT Version :8

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_001165232.1 Gene:cox7c / 100329161 XenbaseID:XB-GENE-965101 Length:63 Species:Xenopus tropicalis

Alignment Length:66 Identity:30/67 (45%)
Similarity:42/67 (63%) Gaps:3/67 (4%)


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |.|::   .|.|:.|.:|.|.:...||:||||.:.||:|:..:.|:....||..||:||||||||
 Frog     1 MFGQA---VRRFATSAIRRSHYEEGPGKNLPFSVENKWRLLGMMTLFFGSGFAFPFVIVRHQLLK 62

  Fly    66 K 66
            |
 Frog    63 K 63

Known Domains:


GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 22/45 (49%)
cox7cNP_001165232.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 22/45 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C288483069
eggNOG 1 0.900 E1_KOG4527
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5125
OMA 1 1.010
OrthoDB 1 1.010 D1642074at2759
OrthoFinder 1 1.000 FOG0005238
OrthoInspector 1 1.000 T1059046
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5099
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.