DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Teh3 and tipE

Sequence 1:NP_652335.1 Gene:Teh3 FlyBaseID:FBgn0040697 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_523920.1 Gene:tipE FlyBaseID:FBgn0003710 Length:452 Species:Drosophila melanogaster

Alignment Length:411 Identity:83/412 (20%)
Similarity:130/412 (32%) Gaps:141/412 (34%)


  Fly    34 SSVALVYLTVAIYMPSTRAFKSGIDPTPVMCTTTRA---VNKDNCEWGSCGEWCLSKTSGACIQI 95
            |..|.::|...:..|:........:..|.:|.|...   ....||.|.||.|.| :|....|.||
  Fly    29 SLFAFLFLVPFVIEPAFTTIFMQFEEVPALCETYDTEIYYGAKNCSWSSCREGC-TKDIYTCTQI 92

  Fly    96 YVNLRSNGSNLIFQNCTNSANKTCYGID-------------QDRADKARCINDECKNLTGTFNCT 147
            .||.|.|     ..|.|:..|.|.|.|:             .||.::|...:.|..||.|     
  Fly    93 RVNYRLN-----LYNFTDEFNFTEYHINLKEAERILPPVKRTDRYERALRSDYEYDNLGG----- 147

  Fly   148 AGQCLNITDAFECIFHNSDAPVKCSGRRGKINCMDISGLYSCSRGTCRKIRTPYNCDRRCVDIPT 212
             |..|:|...              :||..::|..|..|                           
  Fly   148 -GTGLDIDLG--------------AGRMEQLNFGDADG--------------------------- 170

  Fly   213 RNKNVVVLSGDKVYLSQCQNAINAETLEEVWNESSENVAMTSCYFIRHTSDQVDAVDCINGSTLE 277
            .|..::..|.|...||.....|:.|                     |...|::        |.|.
  Fly   171 SNGYLIEDSEDTRGLSASGTLISDE---------------------RRPFDEI--------SELN 206

  Fly   278 TNMLSDLTNFTYLSHLHVSVATPVPEIAPPDVDLTISNESKLMINLEGCVNTLMDECKEFLKDFG 342
            ..::.:.:.:.|:.                         ::|..|::||....|..|..:||.:.
  Fly   207 EGLMGNRSMYYYVG-------------------------ARLFPNVKGCGYPPMLNCTIWLKRYT 246

  Fly   343 RDGSDHNARARFPCFYSPGKKDVVVARFDLEVTYRQFVFASVVPSVLFVVSCSILIMCQTTVYVG 407
            :.|      .:|||:||.....:|::..|........|::..:|...|::|...|......:|..
  Fly   247 KIG------MKFPCYYSKVDPSLVISDLDYWQNTLNLVYSMAIPIPSFIISVIYLTYAYFKIYNE 305

  Fly   408 DDAKMRFKGCVDTETV-LNKN 427
            |:           ||. |:||
  Fly   306 DE-----------ETAPLDKN 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Teh3NP_652335.1 None
tipENP_523920.1 TipE 1..452 CDD:293577 83/412 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130765746
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12335
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.