DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Teh3 and Teh4

Sequence 1:NP_652335.1 Gene:Teh3 FlyBaseID:FBgn0040697 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_647866.2 Gene:Teh4 FlyBaseID:FBgn0035504 Length:524 Species:Drosophila melanogaster

Alignment Length:437 Identity:181/438 (41%)
Similarity:256/438 (58%) Gaps:31/438 (7%)


  Fly     1 MGKKKVPVEDLVVPPQDTRICGTICICQMTLVLSSVALVYLTVAIYMPSTRAFKSGIDPTPVMCT 65
            ||::|  .:..|:|.||.|||..||:||:|:|||.|::|||:||||.||.:|||||.:..||||.
  Fly     1 MGRRK--DKPRVIPEQDARICRAICLCQLTMVLSCVSIVYLSVAIYSPSLKAFKSGFELDPVMCQ 63

  Fly    66 TTRAVNKDNCEWGSCGEWCLSKTSGACIQIYVNLRSNGSNLIFQNCTNSANKTCYGIDQDRADKA 130
            |......:||.|.|||||||:||||.|.||:..:|.||:::...|||...|.:|..||..|.:|.
  Fly    64 TVDRQMPNNCPWASCGEWCLTKTSGFCPQIHSIVRRNGTDIQLNNCTRVTNTSCAMIDLSRLNKF 128

  Fly   131 RCIN-DECKNLTGTFNCTAGQCLNITDAFECIFHNSDA-PVKCSGRRGKINCMDISGLYSCSRGT 193
            .|.| ..|.|:.|.|||:.|.|.|:::.|.| .|.:|. .|.......|:|     |.:.|....
  Fly   129 NCNNGTACNNIRGVFNCSNGHCKNMSEFFLC-HHKADGLTVNSQKDNTKLN-----GFFECHGVH 187

  Fly   194 CRKIRTPYNCDRRCVDIPTRNKNVVVLSGDKVYLSQCQNAI---------NAETLE--EVWNESS 247
            |.||:.|::|||.|..|.|.|.|.:::..|.:..:.|:||:         :...:|  |.|.|..
  Fly   188 CTKIKKPFSCDRYCSKITTTNVNTLIMHEDNLIAADCENAVAFNQARGSEHGVRIEPFEFWKEDD 252

  Fly   248 ENVAMTSCYFIRHTSD-QVDAVDCINGSTLETNML-SDLTNFTYLSHLHVSVATPV-PE--IAPP 307
            .|: :|:|..:...|| ::.|.|||||:.||.:.| :...|||....::.:....| ||  ..|.
  Fly   253 GNL-LTNCATVTRESDNRITATDCINGTLLEHDTLPAPFMNFTQFWAIYENSTRSVDPEQRYLPN 316

  Fly   308 DVDLTISNESKLMINLEGCVNTLMDECKEFLKDFGRDGSDHNARARFPCFYSPGKK-DVVVARFD 371
            ..:|||.:..||.||||||||||..|||:|:..:|.||.::.|::|:.|:|:.... :.||||:|
  Fly   317 QANLTIYSWKKLFINLEGCVNTLRGECKDFVARYGNDGDNNTAQSRYQCYYNKDSNVEFVVARYD 381

  Fly   372 LEVTYRQFVFASVVPSVLFVVSCSILIMCQTTVYVGDDAKMRFKGCV 418
            |:..||:.:.:.:||.||||:|...|.:...:|.||||||||   ||
  Fly   382 LDKVYRELLVSLIVPIVLFVISSISLCIITKSVKVGDDAKMR---CV 425



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130765568
eggNOG 1 0.900 E1_28NS4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12335
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.