DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and Peritrophin-15b

DIOPT Version :9

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001260249.1 Gene:Peritrophin-15b / 50432 FlyBaseID:FBgn0040958 Length:93 Species:Drosophila melanogaster


Alignment Length:93 Identity:30/93 - (32%)
Similarity:46/93 - (49%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VQLALTSLLVISFGIALAYDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKCPSE 67
            |.|.||..:.|...:....||:|:|.|..::.   .:.|:.||.|.||:|.:..:..: :.|...
  Fly     6 VLLFLTLCVAIYADLDCNPDGNGEPDCVGRSG---EISRDFWDPTHYWQCSSTGQAEL-VACEQN 66

  Fly    68 TGFMDSLKNCVNWEEWEWEKPVEPLSEA 95
            |||.....:||:|..|:|   ..|.|||
  Fly    67 TGFDPKTGSCVDWSVWQW---YPPCSEA 91



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.