DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG14645 and CG3348

Sequence 1:NP_652325.2 Gene:CG14645 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001303428.1 Gene:CG3348 FlyBaseID:FBgn0040609 Length:98 Species:Drosophila melanogaster

Alignment Length:75 Identity:25/76 (33%)
Similarity:41/76 (54%) Gaps:1/76 (1%)


  Fly    21 YDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKCPSETGFMDSLKNCVNWEEWEW 85
            ::.:|:|.|:...|:: .:|||.||.|:||.|:.....|...:||....:.:.|..||::.:|.|
  Fly    16 HEHNGEPSCQGLDEVN-RMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAW 79

  Fly    86 EKPVEPLSEA 95
            ..|.||...|
  Fly    80 TDPKEPAGRA 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG14645NP_652325.2 None
CG3348NP_001303428.1 ChtBD2 24..73 CDD:214696 17/50 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130813403
eggNOG 1 0.900 E1_2F5S7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20987
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.